From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000112000
  • symbol?:
  • description?: putative membrane protein (fragment)

      descriptions from strain specific annotations:

    • putative membrane protein (fragment)
    • pseudogene
    • domain of unknown function, putative
  • strand?: +
  • coordinates?: 130362..135172
  • synteny block?: BlockID0000880
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0048
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_0037
    JH9:
    SaurJH9_0037
    JKD6008:
    SAA6008_00047
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0048
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0048
    Mu50:
    SAV0049
    MW2:
    RF122:
    ST398:
    SAPIG0064
    T0131:
    SAT0131_00042
    TCH60:
    TW20:
    SATW20_00810
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------MLVIGILGGFISGLVGIGGAIVIYPALLLLPPLFGLPTYSAYIASGLTSSQV
    N315            MDIANMTIMLLIGVLGGFISGLIGIGGAIIIYPAILILPPLIGIPAYSAYIASGLTSSQV
                            **:**:********:******:****:*:****:*:*:**************

    COL             FFSTLSGSLKAYKNKNFSRTLILNMGSGMVIGSILGALLATVFNSQFVNVIYIIIALLAL
    N315            FFSTLSGSLNARKQPAFSPKLVIYMGGGMLIGSMLGAILASLFNATFVNTVYVIIAILAL
                    *********:* *:  ** .*:: **.**:***:***:**::**: ***.:*:***:***

    COL             ILMFIKVTPSTSHIKFNRVLLITIGGIIGLVSGIVGAGGAFIIIPVLLVIFKLPMNMVVT
    N315            ILMFIKVKPTTQETKSKPLLFIIVGFGIGVISGIVGAGGAFIIIPVLLALFKLPMNTVVN
                    *******.*:*.. * : :*:* :*  **::*****************.:****** **.

    COL             NSIVIAFISSIGAFIIKLLQGYIPINSAIPLILGSILFTPLGMKIGQKIPDSIQKGIVSI
    N315            NSIAIAFISSVGAFFIKLMQGYIPVESAIFLIIE--------------------------
                    ***.******:***:***:*****::*** **:                           

    COL             LIVIAIIKLIF
    N315            -----------