From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000133000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 157284..157622
  • synteny block?: BlockID0001070
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0060
    08BA02176:
    C248_0047
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_0048
    JH9:
    SaurJH9_0047
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_0057
    MRSA252:
    SAR0058
    MSHR1132:
    MSSA476:
    SAS0031
    Mu3:
    SAHV_0059
    Mu50:
    SAV0060
    MW2:
    RF122:
    ST398:
    SAPIG0051
    T0131:
    TCH60:
    TW20:
    SATW20_00350
    USA300_TCH1516:
    USA300HOU_0064
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHTPLAHLTLDTYTYYND
    N315            MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPERFINDSPLAHLTLETYTYYNN
    USA300_FPR3757  MKTTTQELKQYMTRLFQLSNNETWECETLEEAAENILPKRFINDSPLAHLILETYTYYNN
                    ***********:***************:********** **::.:***** *:******:

    COL             ELHELSIYPFLMYTNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGTRHE
    N315            ELHDLSIYPFLMYANNQLISVGYLNHFDMDFLYLTDTKNTIIDERHLLREGGTHHE
    USA300_FPR3757  ELHELSIYPFLMYSNNQLISIGYLDHFDMDFLYLTDTKNTIIDERHLLKEGGNNHE
                    ***:*********:******:***:***********************:***..**