From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000383000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 393174..393377
  • synteny block?: BlockID0001740
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0090
    08BA02176:
    C248_0079
    11819-97:
    71193:
    ST398NM01_2804
    ECT-R 2:
    ED133:
    SAOV_0042
    ED98:
    SAAV_0038
    HO 5096 0412:
    SAEMRSA15_00540
    JH1:
    SaurJH1_0080
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_00069
    LGA251:
    M013:
    MRSA252:
    SAR0100
    MSHR1132:
    MSSA476:
    SAS0060
    Mu3:
    SAHV_0089
    Mu50:
    SAV0090
    MW2:
    MW0060
    RF122:
    SAB0034
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_01090
    USA300_TCH1516:
    USA300HOU_0097
    VC40:
    SAVC_00175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEGLKHSLKSLGWWDLFFAIPIFLLFAYLPNYNFITIFLNIVIIIFFSIGLILTTHIIID
    N315            MEDLKESLKSLGWWDLFFAIPMFLLFAYLPNYNFITIFLNIVIIIFFSIGLILTTHIIID
    NCTC8325        MEGLKHSLKSLGWWDLFFAIPIFLLFAYLPNYNFITIFLNIVIIIFFSIGLILTTHIIID
                    **.**.***************:**************************************

    COL             KIKSNTK
    N315            KIKSNTK
    NCTC8325        KIKSNTK
                    *******