From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000384000
  • symbol?:
  • description?: tfoX N-terminal domain protein

      descriptions from strain specific annotations:

    • tfoX N-terminal domain protein
    • TfoX domain-containing protein
    • TfoX N-terminal domain-containing protein
    • TfoX N-domain family protein
  • strand?: +
  • coordinates?: 393426..393632
  • synteny block?: BlockID0001750
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0091
    08BA02176:
    C248_0080
    11819-97:
    MS7_0084
    71193:
    ST398NM01_0104
    ECT-R 2:
    ECTR2_48
    ED133:
    ED98:
    SAAV_0039
    HO 5096 0412:
    SAEMRSA15_00550
    JH1:
    SaurJH1_0081
    JH9:
    SaurJH9_0078
    JKD6008:
    SAA6008_00076 (tFox)
    JKD6159:
    SAA6159_00070 (tFox)
    LGA251:
    SARLGA251_00700
    M013:
    M013TW_0077
    MRSA252:
    SAR0101
    MSHR1132:
    SAMSHR1132_00660
    MSSA476:
    SAS0061
    Mu3:
    SAHV_0090
    Mu50:
    SAV0091
    MW2:
    MW0061
    RF122:
    SAB0035
    ST398:
    SAPIG0104
    T0131:
    SAT0131_00076 (xerD)
    TCH60:
    HMPREF0772_10400
    TW20:
    SATW20_01100
    USA300_TCH1516:
    USA300HOU_0098
    VC40:
    SAVC_00180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQD
    N315            MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDSVVIGGLYDNRLLVKATKSVRHQLQD
    NCTC8325        MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQD
    Newman          MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQD
    USA300_FPR3757  MATKKDVHDLFLNHVNSNAVKRRKMMGEYIIYYDGVVIGGLYDNRLLVKATKSAQQKLQD
                    ********************* ************.******************.:::***

    COL             NTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK
    N315            NTLVSPYPGAKEMILIPDITEAINLTNLFELIKNDLKN
    NCTC8325        NTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK
    Newman          NTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK
    USA300_FPR3757  NTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK
                    *********:****** *:*** ***:**: ******: