From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000386000
  • symbol?:
  • description?: Trp repressor binding protein

      descriptions from strain specific annotations:

    • Trp repressor binding protein
    • flavodoxin reductase
    • fmn reductase, NADPH-dependent
  • strand?: -
  • coordinates?: 394741..395298
  • synteny block?: BlockID0001770
  • occurrence?: in 44% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0082
    11819-97:
    71193:
    ST398NM01_0106
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00570
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_00072
    LGA251:
    SARLGA251_00720
    M013:
    M013TW_0079
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0063
    Mu3:
    Mu50:
    MW2:
    MW0063
    RF122:
    ST398:
    SAPIG0106
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    VC40:
    SAVC_00190

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------------MNLYQSNIEKVTDNRHSKGANFHNDDYEQI
    NCTC8325        MITCLFGSSRKDGNSAIAVENLLKNLKVNFVNLYQSNIEKVTDNRHSKGANFHNDDYEQI
    Newman          ----------------------MKNLKVNFVNLYQSNIEKVTDNRHSKGANFHNDDYEQI
    USA300_FPR3757  ------------------------------MNLYQSNIEKVTDNRHSKGANFHNDDYEQI
                                                  :*****************************

    COL             LIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQIDNFKEIMSQKKYLILIIGG
    NCTC8325        LIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQIDNFKEIMSQKKYLILIIGG
    Newman          LIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQIDNFKEIMSQKKYLILIIGG
    USA300_FPR3757  LIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQIDNFKEIMSQKKYLILIIGG
                    ************************************************************

    COL             DNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILNDSQFIEELANINLALKKGD
    NCTC8325        DNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILNDSQFIEELANINLALKKGD
    Newman          DNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILNDSQFIEELANINLALKKGD
    USA300_FPR3757  DNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILNDSQFIEELANINLALKKGD
                    ************************************************************

    COL             IYD
    NCTC8325        IYD
    Newman          IYD
    USA300_FPR3757  IYD
                    ***