From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000489000
  • symbol?: tauE
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 524129..524884
  • synteny block?: BlockID0002190
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0084
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_42
    ED133:
    SAOV_0036
    ED98:
    SAAV_0032
    HO 5096 0412:
    JH1:
    SaurJH1_0073
    JH9:
    SaurJH9_0071
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00630
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0054
    Mu3:
    SAHV_0083
    Mu50:
    SAV0084
    MW2:
    MW0054
    RF122:
    SAB0028c
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0090
    VC40:
    SAVC_00135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQV
    N315            MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQV
    NCTC8325        MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQV
    Newman          MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQV
    USA300_FPR3757  MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQV
                    ************************************************************

    COL             FFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLAL
    N315            FFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLAL
    NCTC8325        FFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLAL
    Newman          FFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLAL
    USA300_FPR3757  FFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLAL
                    ************************************************************

    COL             TLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVA
    N315            TLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVA
    NCTC8325        TLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVA
    Newman          TLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVA
    USA300_FPR3757  TLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVA
                    ************************************************************

    COL             NSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISI
    N315            NSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISI
    NCTC8325        NSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISI
    Newman          NSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISI
    USA300_FPR3757  NSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISI
                    ************************************************************

    COL             LIVFAIVQLIL
    N315            LIVFAIVQLIL
    NCTC8325        LIVFAIVQLIL
    Newman          LIVFAIVQLIL
    USA300_FPR3757  LIVFAIVQLIL
                    ***********