From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000849000
  • symbol?:
  • description?: Superfamily I DNA/RNA helicase protein

      descriptions from strain specific annotations:

    • Superfamily I DNA/RNA helicase protein
    • pseudogene
    • ATPase associated with various cellular activities family protein
  • strand?: +
  • coordinates?: 1108219..1112130
  • synteny block?: BlockID0004130
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0093
    08BA02176:
    11819-97:
    MS7_0086
    71193:
    ECT-R 2:
    ECTR2_50
    ED133:
    SAOV_0045
    ED98:
    SAAV_0041
    HO 5096 0412:
    SAEMRSA15_00630
    JH1:
    SaurJH1_0083
    JH9:
    SaurJH9_0080
    JKD6008:
    SAA6008_00078
    JKD6159:
    LGA251:
    M013:
    M013TW_0085
    MRSA252:
    SAR0103
    MSHR1132:
    MSSA476:
    SAS0068
    Mu3:
    SAHV_0092
    Mu50:
    SAV0093
    MW2:
    MW0068
    RF122:
    ST398:
    T0131:
    SAT0131_00080
    TCH60:
    HMPREF0772_10397
    TW20:
    SATW20_01120
    USA300_TCH1516:
    USA300HOU_0106
    VC40:
    SAVC_00215

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNAERF
    N315            MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNSERF
    NCTC8325        MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNAERF
    Newman          MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNAERF
    USA300_FPR3757  MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQLQSFDEYFEIWNAERF
                    ********************************************************:***

    COL             IISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPNGTHCYGYTFNTDKHGK
    N315            IISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSDIHNPNGTHCYGYTFNTDKHGK
    NCTC8325        IISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPNGTHCYGYTFNTDKHGK
    Newman          IISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPNGTHCYGYTFNTDKHGK
    USA300_FPR3757  IISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPNGTHCYGYTFNTDKHGK
                    **************************************:*********************

    COL             VIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKEILADEPINEFKLKKMDK
    N315            VIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFFQKVKEILADEPINEFKLKKMDK
    NCTC8325        VIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKEILADEPINEFKLKKMDK
    Newman          VIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKEILADEPINEFKLKKMDK
    USA300_FPR3757  VIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKEILADEPINEFKLKKMDK
                    *************************************.**********************

    COL             AYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIE
    N315            AYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIE
    NCTC8325        AYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIE
    Newman          AYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIE
    USA300_FPR3757  AYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFISDIEKARKSPNQTLIDYIE
                    ************************************************************

    COL             GVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSV
    N315            GVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSV
    NCTC8325        GVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSV
    Newman          GVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSV
    USA300_FPR3757  GVEESQHIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSLMQQLAVNQITSGNERISSV
                    ******:*****************************************************

    COL             NGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKY
    N315            NGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKY
    NCTC8325        NGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKY
    Newman          NGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKY
    USA300_FPR3757  NGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKTKIHETDDKYVYLLKESIAKY
                    ************************************************************

    COL             KMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIG
    N315            KMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIG
    NCTC8325        KMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIG
    Newman          KMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIG
    USA300_FPR3757  KMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQNYANLAHELKDFAEIAEDLIG
                    ************************************************************

    COL             ESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRA
    N315            ESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRA
    NCTC8325        ESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRA
    Newman          ESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRA
    USA300_FPR3757  ESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLLQNENNRMSYNELMSEWQSHQRA
                    ************************************************************

    COL             FLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEI
    N315            FLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEI
    NCTC8325        FLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEI
    Newman          FLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEI
    USA300_FPR3757  FLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINSEKTSIEEQVYHLDNETLRDNKEI
                    ************************************************************

    COL             EDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQ
    N315            EDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQ
    NCTC8325        EDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQ
    Newman          EDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQ
    USA300_FPR3757  EDLDNRINYIVKQIETLNELIKSIKESNKGFINKLKAMFNSEEDESYKDHNKEKQQLLTQ
                    ************************************************************

    COL             QLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEK
    N315            QLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEK
    NCTC8325        QLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEK
    Newman          QLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEK
    USA300_FPR3757  QLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQLDELNSQLQELEAYRIESKITIPEK
                    ************************************************************

    COL             DFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRK
    N315            DFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRK
    NCTC8325        DFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRK
    Newman          DFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRK
    USA300_FPR3757  DFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAMILHKLLLIANNTTIYYAINDFKDRRK
                    ************************************************************

    COL             LIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVG
    N315            LIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVG
    NCTC8325        LIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVG
    Newman          LIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVG
    USA300_FPR3757  LIDANPDKVHNAWNVMHLIFPVVSTTFASFKSMYGGIPKDFIDYLFIDEAGQAIPQAAVG
                    ************************************************************

    COL             ALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGF
    N315            ALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGF
    NCTC8325        ALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGF
    Newman          ALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGF
    USA300_FPR3757  ALYRSKKVVAVGDPIQIEPVVTLESHLIDNIRKNYHVPEYLVSKEASVQSVADNANQYGF
                    ************************************************************

    COL             WKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKG
    N315            WKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKG
    NCTC8325        WKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKG
    Newman          WKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKG
    USA300_FPR3757  WKSDATDSNQKTWIGIPLWVHRRCLKPMFTIANQIAYNNKMVLPSNITKVGKTGWYDVKG
                    ************************************************************

    COL             NAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTR
    N315            NAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTR
    NCTC8325        NAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTR
    Newman          NAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTR
    USA300_FPR3757  NAVQKQFVKEHGEKVVGLLADDWIEAIKEGKNEPSSFVISPFSAVQQQIKRMLKQQLPTR
                    ************************************************************

    COL             IDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTR
    N315            IDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTR
    NCTC8325        IDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTR
    Newman          IDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTR
    USA300_FPR3757  IDIERTKINQWVDKSIGTVHTFQGKEAQKVYFVIGTDNTQDGAVNWSCEKPNLLNVAVTR
                    ************************************************************

    COL             AKKEFYVIGDMQRIQMKPFYETIFKERNVK
    N315            AKKEFYVIGDMQRIQMKPFYETIFKERNVK
    NCTC8325        AKKEFYVIGDMQRIQMKPFYETIFKERNVK
    Newman          AKKEFYVIGDMQRIQMKPFYETIFKERNVK
    USA300_FPR3757  AKKEFYVIGDMQRIQMKPFYETIFKERNVK
                    ******************************