From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000861000
  • symbol?:
  • description?: putative lipoprotein

      descriptions from strain specific annotations:

    • putative lipoprotein
    • tandem lipoprotein
    • staphylococcus tandem lipoproteins family protein
    • Membrane lipoprotein
  • strand?: +
  • coordinates?: 1128177..1153528
  • synteny block?: BlockID0004220
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0100
    08BA02176:
    C248_0090
    11819-97:
    71193:
    ST398NM01_2805
    ECT-R 2:
    ECTR2_57
    ED133:
    ED98:
    SAAV_0068
    HO 5096 0412:
    SAEMRSA15_00690
    JH1:
    SaurJH1_0091
    JH9:
    SaurJH9_0088
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    M013TW_0089
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0099
    Mu50:
    SAV0100
    MW2:
    RF122:
    ST398:
    SAPIG0114
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0112
    VC40:
    SAVC_00245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRLNKLVLYISFLILVISFTAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDD
    N315            MKRLNKLVLYISFLILVISFTAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRDD
    NCTC8325        MKRLNKLVLYISFLILVISFTAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDD
    Newman          MKRLNKLVLYISFLILVISFTAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDD
    USA300_FPR3757  MKRLNKLVLYISFLILVISFTAGCGIGKEAEVKKSFEKTLSMYPIKNLEDLYDKEGYRDD
                    *************************:*****:****************************

    COL             EFDKNDKGTWIIGSEMVVQPKGERMKSKGMVLYMNRNTKTTTGKYIVSETLHDEDGRPKS
    N315            QFDKNDKGTWIINSEMVVQPKGERMKSKGMVLYMNRNTKTTTGKYIVSETLHDEDGRPKS
    NCTC8325        EFDKNDKGTWIIGSEMVVQPKGERMKSKGMVLYMNRNTKTTTGKYIVSETLHDEDGRPKS
    Newman          EFDKNDKGTWIIGSEMVVQPKGERMKSKGMVLYMNRNTKTTTGKYIVSETLHDEDGRPKS
    USA300_FPR3757  EFDKNDKGTWIIGSEMVVQPKGERMKSKGMVLYMNRNTKTTTGKYIVSETLHDEDGRPKS
                    :***********.***********************************************

    COL             KDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPS
    N315            KDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPS
    NCTC8325        KDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPS
    Newman          KDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPS
    USA300_FPR3757  KDKEYPVKMVDNKIIPTKGIKDENIKKEIENFKFFAQYGSFKDLSKYKDGDISYNPEVPS
                    ************************************************************

    COL             YSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGSSVGYKDIEFTFVEKKGEN
    N315            YSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGSSVGYKDIEFTFVEKKGEN
    NCTC8325        YSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGSSVGYKDIEFTFVEKKGEN
    Newman          YSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGSSVGYKDIEFTFVEKKGEN
    USA300_FPR3757  YSAKYQLTNDDYNVKQLRKRYKIPTNKAPKLLLKGSGDLKGSSVGYKDIEFTFVEKKGEN
                    ************************************************************

    COL             TFFTDSLHLEPSEDK
    N315            TFFTDSLHLEPSEDK
    NCTC8325        TFFTDSLHLEPSEDK
    Newman          TFFTDSLHLEPSEDK
    USA300_FPR3757  TFFTDSLHLEPSEDK
                    ***************