From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000862000
  • symbol?:
  • description?: tandem lipoprotein

      descriptions from strain specific annotations:

    • tandem lipoprotein
    • staphylococcus tandem lipoproteins family protein
    • putative lipoprotein
  • strand?: +
  • coordinates?: 1128997..1132094
  • synteny block?: BlockID0004230
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0099
    08BA02176:
    11819-97:
    MS7_0090
    71193:
    ECT-R 2:
    ECTR2_56
    ED133:
    ED98:
    SAAV_0067
    HO 5096 0412:
    JH1:
    SaurJH1_0090
    JH9:
    SaurJH9_0087
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_00750
    MSSA476:
    SAS0074
    Mu3:
    SAHV_0098
    Mu50:
    SAV0099
    MW2:
    MW0073
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0111
    VC40:
    SAVC_00240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMT---------------------------------------------------------
    N315            MMKRLNKLVLGISFLFLVISITAGCGMGKEAEIKKSFEKTMSMYPIKNLEDLYDKEGYRD
    NCTC8325        MMKRLNKLVLGIIFLFLVISITAGCGIGKEAKIKKSFEKTLSMYPIKNLEDLYDKEGYRD
    Newman          MMKRLNKLVLGIIFLFLVISITAGCGIGKEAKIKKSFEKTLSMYPIKNLEDLYDKEGYRD
    USA300_FPR3757  MMKRLNKLVLGIIFLFLVISITAGCGIGKEAKIKKSFEKTLSMYPIKNLEDLYDKEGYRD
                    **.                                                         

    COL             -KFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQ
    N315            DQFDKNDKGTWIVNSQMAIQNKGEPMKSKGMVLYMNRNTRTTNGYYYVNVIKGEDKGKHQ
    NCTC8325        DEFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQ
    Newman          DEFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQ
    USA300_FPR3757  DEFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQ
                     :**********:.*:** *****.:* ***********:**:******.**.:..*: *

    COL             ENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVP
    N315            DNEKRYPVKMVDNKIILTKEIKDENIKIEIENFKFFVQYGNFKDLENYKDGDISYNPEVP
    NCTC8325        ENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVP
    Newman          ENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVP
    USA300_FPR3757  ENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVP
                    :*************** ******:*** *****************.:*************

    COL             SYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEE
    N315            SYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEE
    NCTC8325        SYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEE
    Newman          SYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEE
    USA300_FPR3757  SYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEE
                    ************************************************************

    COL             NIYFSDGLIFKPSEDK
    N315            NIYFSDGLIFKPSEDK
    NCTC8325        NIYFSDGLIFKPSEDK
    Newman          NIYFSDGLIFKPSEDK
    USA300_FPR3757  NIYFSDGLIFKPSEDK
                    ****************