From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000891000
  • symbol?:
  • description?: AraC family transcriptional regulator

      descriptions from strain specific annotations:

    • AraC family transcriptional regulator
    • Amino-terminal domain protein
    • regulatory helix-turn-helix proteins, AraC family protein
    • putative regulatory protein
    • bacterial regulatory helix-turn-helix s, AraC family protein
    • xylan 1,4-beta-xylosidase
    • AraC family regulatory protein
    • bifunctional AraC family transcriptional regulator/xylan 1,4-beta-xylosidase
    • HTH-type transcriptional regulator
    • putative transcriptional regulator
    • transcriptional regulator, AraC family
    • pseudogene
    • HTH-type transcriptional regulator AraC
  • strand?: +
  • coordinates?: 1156225..1158474
  • synteny block?: BlockID0004300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0101
    08BA02176:
    C248_0091
    11819-97:
    MS7_0095
    71193:
    ST398NM01_0115
    ECT-R 2:
    ECTR2_58
    ED133:
    SAOV_0051
    ED98:
    SAAV_0069
    HO 5096 0412:
    SAEMRSA15_00700
    JH1:
    SaurJH1_0092
    JH9:
    SaurJH9_0089
    JKD6008:
    SAA6008_00082
    JKD6159:
    SAA6159_00085
    LGA251:
    SARLGA251_00770
    M013:
    M013TW_0091
    MRSA252:
    SAR0107
    MSHR1132:
    SAMSHR1132_00770
    MSSA476:
    SAS0078
    Mu3:
    SAHV_0100
    Mu50:
    SAV0101
    MW2:
    MW0077
    RF122:
    SAB0041
    ST398:
    SAPIG0115
    T0131:
    SAT0131_00084 (zwf)
    TCH60:
    HMPREF0772_10393
    TW20:
    SATW20_01160
    USA300_TCH1516:
    USA300HOU_0113
    VC40:
    SAVC_00250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------MSDFKRLNSLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLYRF
    N315            MQRDYLIRVETESMPDFKRLNGLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLYRF
    NCTC8325        -------------MSDFKRLNSLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLYRF
    Newman          MQRDYLIRVETESMSDFKRLNSLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLYRF
    USA300_FPR3757  -------------MSDFKRLNSLMIGFVIKGEAHIYDENNMTQCNSGDIFIINHRDLYRF
                                 *.******.**************************************

    COL             QLQQDGIICYIQFQMKYLADKFDDVHCLYFHLTDATTTKNIHQLRNIMARLVSTHIRHNE
    N315            QLQQDGIICYIQFQMKYLADKFDDAHCLYFHLTDATTTKNIHQLRNIMARLVSTHIRHNE
    NCTC8325        QLQQDGIICYIQFQMKYLADKFDDVHCLYFHLTDATTTKNIHQLRNIMARLVSTHIRHNE
    Newman          QLQQDGIICYIQFQMKYLADKFDDVHCLYFHLTDATTTKNIHQLRNIMARLVSTHIRHNE
    USA300_FPR3757  QLQQDGIICYIQFQMKYLADKFDDVHCLYFHLTDATTTKNIHQLRNIMARLVSTHIRHNE
                    ************************.***********************************

    COL             LSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSELSEY
    N315            LSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSELSEY
    NCTC8325        LSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSELSEY
    Newman          LSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSELSEY
    USA300_FPR3757  LSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDYIELHFHEDLSLSELSEY
                    ************************************************************

    COL             VGWSESHLSKKFTESLGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSAASFAR
    N315            VGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSAASFAR
    NCTC8325        VGWSESHLSKKFTESLGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSAASFAR
    Newman          VGWSESHLSKKFTESLGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSAASFAR
    USA300_FPR3757  VGWSESHLSKKFTESLGVGFHHFLNTTRIEHAKLDLTYTDETITDIALQNGFSSAASFAR
                    ********************:***************************************

    COL             TFKHFTHQTPKQYRGDRPAITENQQSAQHDYHDRELILLLNDYIEEMNHFIEDIEKMNYK
    N315            TFKHFTHQTPKQYRGDRPAITENQQSAQHNYHDRELILLLNDYIEEMNHFIEDIEKMNYK
    NCTC8325        TFKHFTHQTPKQYRGDRPAITENQQSAQHDYHDRELILLLNDYIEEMNHFIEDIEKMNYK
    Newman          TFKHFTHQTPKQYRGDRPAITENQQSAQHDYHDRELILLLNDYIEEMNHFIEDIEKMNYK
    USA300_FPR3757  TFKHFTHQTPKQYRGDRPAITENQQSAQHDYHDRELILLLNDYIEEMNHFIEDIEKMNYK
                    *****************************:******************************

    COL             EIAFQPTNHQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVIPYIMKKL
    N315            EIAFKPTNQQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVMPYIMKKL
    NCTC8325        EIAFQPTNHQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVIPYIMKKL
    Newman          EIAFQPTNHQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVIPYIMKKL
    USA300_FPR3757  EIAFQPTNHQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHHDFQVNEVLAYDVIPYIMKKL
                    ****:***:*******************************************:*******

    COL             NAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLDQYDSRDYIDAFKIFIHHVALHVSH
    N315            NAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLNQYDSRDYIDAFKVFIHHVALHVSH
    NCTC8325        NAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLDQYDSRDYIDAFKIFIHHVALHVSH
    Newman          NAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLDQYDSRDYIDAFKIFIHHVALHVSH
    USA300_FPR3757  NAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLDQYDSRDYIDAFKIFIHHVALHVSH
                    ***********************************:************:***********

    COL             RKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRLEPHIDHFVF
    N315            RKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRLEPHINHFVF
    NCTC8325        RKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRLEPHIDHFVF
    Newman          RKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRLEPHIDHFVF
    USA300_FPR3757  RKDLKFNLYVTTLHTSLIEMIDYFKALFPNGGLYIHLDQATERHLPLLKRLEPHIDHFVF
                    *******************************************************:****

    COL             DANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHRLKRPLILLNWNTLTGDTFIT
    N315            DANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHNLKRPLILLNWNTLTGDTFIT
    NCTC8325        DANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHRLKRPLILLNWNTLTGDTFIT
    Newman          DANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHRLKRPLILLNWNTLTGDTFIT
    USA300_FPR3757  DANSNDAVDFNKMNDDEFKTASQMIINKTNYLIDLMHRHRLKRPLILLNWNTLTGDTFIT
                    ***************************************.********************

    COL             NGEYFRGGIIIEQLLKLSSKVEGIGYWLNYDLHVSHCKNERDYMNSIELFHQYNGKRPVY
    N315            NGEYFRGGIIIEQLLKLSTKVEGIGYWLNYDLHVSHCRNERDYMNSIELFHQYNGKRPVY
    NCTC8325        NGEYFRGGIIIEQLLKLSSKVEGIGYWLNYDLHVSHCKNERDYMNSIELFHQYNGKRPVY
    Newman          NGEYFRGGIIIEQLLKLSSKVEGIGYRLNYDLHVSHCKNERDYMNSIELFHQYNGKRPVY
    USA300_FPR3757  NGEYFRGGIIIEQLLKLSSKVEGIGYWLNYDLHVSHCKNERDYMNSIELFHQYNGKRPVY
                    ******************:******* **********:**********************

    COL             FTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQMNMRATEMIHLN
    N315            FTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQMNMRATEMIHLN
    NCTC8325        FTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQMNMRATEMIHLN
    Newman          FTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQMNMRATEMIHLN
    USA300_FPR3757  FTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYDAKHFNPYLALDNQMNMRATEMIHLN
                    ************************************************************

    COL             INALEEGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRMSFPKLEVYDIDIT
    N315            INALEDGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRMSFPKLEVYDIDIT
    NCTC8325        INALEEGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRMSFPKLEVYDIDIT
    Newman          INALEEGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRMSFPKLEVYDIDIT
    USA300_FPR3757  INALEEGMYKIKHFTLDKENGALFNLWRKHHTIHGMDKDSIDYVNRMSFPKLEVYDIDIT
                    *****:******************************************************

    COL             DTLALNIKMITNGIHLIEVKRYPSS
    N315            DTLALNIKMITNGIHLIEVKRYPSS
    NCTC8325        DTLALNIKMITNGIHLIEVKRYPSS
    Newman          DTLALNIKMITNGIHLIEVKRYPSS
    USA300_FPR3757  DTLALNIKMITNGIHLIEVKRYPSS
                    *************************