From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000893000
  • symbol?:
  • description?: aminoacylase

      descriptions from strain specific annotations:

    • aminoacylase
    • amidohydrolase
    • M20/M25/M40 family peptidase
    • Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A
    • M20 family peptidase
    • amidohydrolase family protein
    • putative peptidase
    • peptidase, M20/M25/M40 family
    • carboxypeptidase, M20(D) family
  • strand?: +
  • coordinates?: 1158625..1159812
  • synteny block?: BlockID0004320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0102
    08BA02176:
    C248_0092
    11819-97:
    MS7_0096
    71193:
    ST398NM01_0116
    ECT-R 2:
    ECTR2_59
    ED133:
    SAOV_0052
    ED98:
    SAAV_0070
    HO 5096 0412:
    SAEMRSA15_00710
    JH1:
    SaurJH1_0093
    JH9:
    SaurJH9_0090
    JKD6008:
    SAA6008_00083
    JKD6159:
    SAA6159_00086
    LGA251:
    SARLGA251_00780
    M013:
    M013TW_0092
    MRSA252:
    SAR0108
    MSHR1132:
    SAMSHR1132_00780
    MSSA476:
    SAS0079
    Mu3:
    SAHV_0101
    Mu50:
    SAV0102
    MW2:
    MW0078
    RF122:
    SAB0042
    ST398:
    SAPIG0116
    T0131:
    SAT0131_00085
    TCH60:
    HMPREF0772_10392 (hipO)
    TW20:
    SATW20_01170
    USA300_TCH1516:
    USA300HOU_0114
    VC40:
    SAVC_00255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MNQQLIETLKSKEGKMIEIRRYLHQHPELSFHEDETAKYIAEFYKGKDVEVETNVGP
    N315            ---MNQQLIEALKSKEDKMIEIRRYLHQHPELSFHEDETAKYIAEFYKGKDVEVETNVGP
    NCTC8325        ---MNQQLIETLKSKEGKMIEIRRYLHQHPELSFHEDETAKYIAEFYKGKDVEVETNVGP
    Newman          MKDMNQQLIETLKSKEGKMIEIRRYLHQHPELSFHEDETAKYIAEFYKGKDVEVETNVGP
    USA300_FPR3757  ---MNQQLIETLKSKEGKMIEIRRYLHQHPELSFHEDETAKYIAEFYKGKDVEVETNVGP
                       *******:*****.*******************************************

    COL             RGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACGHDAHTAYMLVLAE
    N315            RGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACGHDAHTAYMLVLAE
    NCTC8325        RGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACGHDAHTAYMLVLAE
    Newman          RGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACGHDAHTAYMLVLAE
    USA300_FPR3757  RGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACGHDAHTAYMLVLAE
                    ************************************************************

    COL             TLAEMKDSFTGKVVVIHQPAEEVPPGGAKTMIENGVLDGVDHVLGVHVMSTMKTGKVYYR
    N315            TLAEMKDSFTGKVVVIHQPAEEVPPGGAKAMIENGVLDGVDHVLGVHVMSTMKTGNVYYR
    NCTC8325        TLAEMKDSFTGKVVVIHQPAEEVPPGGAKTMIENGVLDGVDHVLGVHVMSTMKTGKVYYR
    Newman          TLAEMKDSFTGKVVVIHQPAEEVPPGGAKTMIENGVLDGVDHVLGVHVMSTMKTGKVYYR
    USA300_FPR3757  TLAEMKDSFTGKVVVIHQPAEEVPPGGAKTMIENGVLDGVDHVLGVHVMSTMKTGKVYYR
                    *****************************:*************************:****

    COL             PGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTVVSRRLSPFETGVVTI
    N315            PGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTVVSRRLSPFETGVVTI
    NCTC8325        PGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTVVSRRLSPFETGVVTI
    Newman          PGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTVVSRRLSPFETGVVTI
    USA300_FPR3757  PGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTVVSRRLSPFETGVVTI
                    ************************************************************

    COL             GSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGLEDMYGVTCTLEYNDDY
    N315            GSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGLEDMYGVTCTLEYNDDY
    NCTC8325        GSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGLEDMYGVTCTLEYNDDY
    Newman          GSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGLEDMYGVTCTLEYNDDY
    USA300_FPR3757  GSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIEKEIKRLSKGLEDMYGVTCTLEYNDDY
                    ************************************************************

    COL             PALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAKERPSAFIYTGAAVENGE
    N315            PALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAKERPSAFIYTGAAVEDGE
    NCTC8325        PALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAKERPSAFIYTGAAVENGE
    Newman          PALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAKERPSAFIYTGAAVENGE
    USA300_FPR3757  PALYNDPEFTEYVAKTLKEANLDFGVEMCEPQPPSEDFAYYAKERPSAFIYTGAAVENGE
                    *********************************************************:**

    COL             IYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN
    N315            IYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN
    NCTC8325        IYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN
    Newman          IYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN
    USA300_FPR3757  IYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN
                    ***********************************