From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000894000
  • symbol?: norC
  • description?: major facilitator transporter

      descriptions from strain specific annotations:

    • major facilitator transporter
    • drug transporter, putative
    • antibiotic resistance-related transmembrane efflux protein
    • major facilitator superfamily protein
    • putative drug transporter
    • quinolone resistance protein norB
    • transporter protein
    • putative transporter protein
    • major facilitator superfamily transporter
    • major facilitator family transporter
    • MFS family major facilitator transporter
    • putative antibiotic resistance-related transmembrane efflux protein
    • multidrug resistance protein B
  • strand?: +
  • coordinates?: 1159814..1161202
  • synteny block?: BlockID0004330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0103
    08BA02176:
    C248_0093
    11819-97:
    MS7_0097
    71193:
    ST398NM01_0117
    ECT-R 2:
    ECTR2_60
    ED133:
    SAOV_0053
    ED98:
    SAAV_0071
    HO 5096 0412:
    SAEMRSA15_00720
    JH1:
    SaurJH1_0094
    JH9:
    SaurJH9_0091
    JKD6008:
    SAA6008_00084
    JKD6159:
    SAA6159_00087
    LGA251:
    SARLGA251_00790 (norC)
    M013:
    M013TW_0093
    MRSA252:
    SAR0109
    MSHR1132:
    SAMSHR1132_00790
    MSSA476:
    SAS0080
    Mu3:
    SAHV_0102
    Mu50:
    SAV0103
    MW2:
    MW0079
    RF122:
    SAB0043
    ST398:
    SAPIG0117
    T0131:
    SAT0131_00086 (malA)
    TCH60:
    HMPREF0772_10391
    TW20:
    SATW20_01180 (norC)
    USA300_TCH1516:
    USA300HOU_0115
    VC40:
    SAVC_00260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGTDMGTISIAVSLTALFSGM
    N315            MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGADMGTISIAVSLTALFSGM
    NCTC8325        MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGTDMGTISIAVSLTALFSGM
    Newman          MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGTDMGTISIAVSLTALFSGM
    USA300_FPR3757  MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGTDMGTISIAVSLTALFSGM
                    *****************************************:******************

    COL             FVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILGRVIQGVSAACIMPSTL
    N315            FVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILGRVIQGVSAACIMPSTL
    NCTC8325        FVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILGRVIQGVSAACIMPSTL
    Newman          FVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILGRVIQGVSAACIMPSTL
    USA300_FPR3757  FVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILGRVIQGVSAACIMPSTL
                    ************************************************************

    COL             AIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGWRWIFIFSIIVAVLSMLL
    N315            AIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGWRWIFIFSIIVAVLSMLL
    NCTC8325        AIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGWRWIFIFSIIVAVLSMLL
    Newman          AIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGWRWIFIFSIIVAVLSMLL
    USA300_FPR3757  AIMKTYYQGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGWRWIFIFSIIVAVLSMLL
                    ************************************************************

    COL             IKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAF
    N315            IKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAF
    NCTC8325        IKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAF
    Newman          IKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAF
    USA300_FPR3757  IKGTPETKSEITNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAF
                    ************************************************************

    COL             FIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGTLIVANTFVQQGLGYTALQA
    N315            FIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGTLIVANTFVQQGLGYTALQA
    NCTC8325        FIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGFAGTLIVANTFVQQGLGYTALQA
    Newman          FIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGTLIVANTFVQQGLGYTALQA
    USA300_FPR3757  FIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGTLIVANTFVQQGLGYTALQA
                    *************************************.**********************

    COL             GYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVIGIALISLVFLPGIFYVISCV
    N315            GYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVIGIALISLVFLPGIFYVISCV
    NCTC8325        GYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVIGIALISLVFLPGIFYVISCV
    Newman          GYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVIGIALISLVFLPGIFYVISCV
    USA300_FPR3757  GYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVIGIALISLVFLPGIFYVISCV
                    ************************************************************

    COL             VGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMASSLGGAFGVAISGAVYAGAV
    N315            VGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMASSLGGAFGVAISGAVYVGAV
    NCTC8325        VGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMASSLGGAFGVAISGAVYAGAV
    Newman          VGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMASSLGGAFGVAISGAVYAGAV
    USA300_FPR3757  VGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMASSLGGAFGVAISGAVYAGAV
                    ********************************************************.***

    COL             AATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK
    N315            AATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK
    NCTC8325        AATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK
    Newman          AATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK
    USA300_FPR3757  AATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK
                    ******************************************