From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000905000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 1172220..1172729
  • synteny block?: BlockID0004420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0110
    08BA02176:
    C248_0096
    11819-97:
    MS7_0101
    71193:
    ST398NM01_0120
    ECT-R 2:
    ECTR2_65
    ED133:
    SAOV_0056
    ED98:
    SAAV_0076
    HO 5096 0412:
    SAEMRSA15_00750
    JH1:
    SaurJH1_0100
    JH9:
    SaurJH9_0096
    JKD6008:
    SAA6008_00087
    JKD6159:
    SAA6159_00092
    LGA251:
    SARLGA251_00840
    M013:
    M013TW_0098
    MRSA252:
    SAR0112
    MSHR1132:
    SAMSHR1132_00850
    MSSA476:
    SAS0083
    Mu3:
    SAHV_0108
    Mu50:
    SAV0109
    MW2:
    MW0082
    RF122:
    SAB0048
    ST398:
    SAPIG0120
    T0131:
    SAT0131_00091 (marR)
    TCH60:
    HMPREF0772_10388
    TW20:
    SATW20_01210
    USA300_TCH1516:
    USA300HOU_0120
    VC40:
    SAVC_00285

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKIRSFTILSLLIYLAMMCYTVVTYPKLPTKVPIHYNLAGDADNFADKWVLLLINSAFI
    N315            MSKIRSFTILSLLIYLAMMCYTVVTYSKLPTKVPIHYNLAGDADNFADKWVLLLINSAFI
    NCTC8325        MSKIRSFTILSLLIYLAMMCYTVVTYPKLPTKVPIHYNLAGDADNFADKWVLLLINSAFI
    Newman          MSKIRSFTILSLLIYLAMMCYTVVTYPKLPTKVPIHYNLAGDADNFADKWVLLLINSAFI
    USA300_FPR3757  MSKIRSFTILSLLIYLAMMCYTVVTYPKLPTKVPIHYNLAGDADNFADKWVLLLINSAFI
                    **************************.*********************************

    COL             VIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIMSYMSIFTVLEIWQIQH
    N315            VIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIMSYMSIFTVLEIWQIQH
    NCTC8325        VIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIMSYMSIFTVLEIWQIQH
    Newman          VIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIMSYMSIFTVLEIWQIQH
    USA300_FPR3757  VIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIMSYMSIFTVLEIWQIQH
                    ************************************************************

    COL             HHQFNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ
    N315            HHQLNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ
    NCTC8325        HHQFNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ
    Newman          HHQFNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ
    USA300_FPR3757  HHQFNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ
                    ***:*********************************