From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000906000
  • symbol?: lctP1
  • description?: L-lactate permease

      descriptions from strain specific annotations:

    • L-lactate permease
    • glycolate permease GlcA
    • Lactate transporter LctP family protein
    • LctP family L-lactate permease
    • L-lactate permease 1
    • L-lactate permease homologue
    • L-lactate permease-like protein
    • L-lactate transport
    • transporter, lactate permease family protein
  • strand?: +
  • coordinates?: 1172992..1174584
  • synteny block?: BlockID0004430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0106 (lctP)
    NCTC8325:
    Newman:
    NWMN_0054 (lctP)
    USA300_FPR3757:
    04-02981:
    SA2981_0111 (lctP)
    08BA02176:
    C248_0097 (lldP1)
    11819-97:
    MS7_0102
    71193:
    ST398NM01_0121
    ECT-R 2:
    ECTR2_66
    ED133:
    SAOV_0057
    ED98:
    SAAV_0077
    HO 5096 0412:
    SAEMRSA15_00760 (lldP1)
    JH1:
    SaurJH1_0101
    JH9:
    SaurJH9_0097
    JKD6008:
    SAA6008_00088
    JKD6159:
    SAA6159_00093
    LGA251:
    SARLGA251_00850 (lldP1)
    M013:
    M013TW_0099
    MRSA252:
    SAR0113 (lldP1)
    MSHR1132:
    SAMSHR1132_00860
    MSSA476:
    SAS0084
    Mu3:
    SAHV_0109 (lctP)
    Mu50:
    SAV0110 (lctP)
    MW2:
    MW0083 (lctP)
    RF122:
    SAB0049 (lldP)
    ST398:
    SAPIG0121
    T0131:
    SAT0131_00094
    TCH60:
    HMPREF0772_10387 (lctP)
    TW20:
    SATW20_01220 (lldP1)
    USA300_TCH1516:
    USA300HOU_0121 (lctP)
    VC40:
    SAVC_00290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTLVVTLIVALFVFELPA
    N315            MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTLVVTLIVALFVFELPA
    NCTC8325        MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTLVVTLIVALFVFELPA
    Newman          MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTLVVTLIVALFVFELPA
    USA300_FPR3757  MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTLVVTLIVALFVFELPA
                    ************************************************************

    COL             RVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDSIASISVDQRIQLLLIG
    N315            RVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDSIASISEDQRIQLLLIG
    NCTC8325        RVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDSIASISVDQRIQLLLIG
    Newman          RVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDSIASISVDQRIQLLLIG
    USA300_FPR3757  RVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDSIASISVDQRIQLLLIG
                    ************************************************* **********

    COL             FCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANGAAGAFGAIGLPVSIIDT
    N315            FCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANGAAGAFGAIGLPVSIIDT
    NCTC8325        FCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANGAAGAFGAIGLPVSIIDT
    Newman          FCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANGAAGAFGAIGLPVSIIDT
    USA300_FPR3757  FCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANGAAGAFGAIGLPVSIIDT
                    ************************************************************

    COL             FNLSGGVTTLDVARYSALTLPILNFIIPFVLVFIVDGMKGIKEILPVILTVSGTYTGLQL
    N315            FNLSGGVTTLDVARYSALTLPILNFIIPFVLVFIVDGMKGIKEILPVILTVSGTYTGLQL
    NCTC8325        FNLSGGVTTLDVARYSALTLPILNFIIPFVLVFIVDGMKGIKEILPVILTVSGTYTGLQL
    Newman          FNLSGGVTTLDVARYSALTLPILNFIIPFVLVFIVDGMKGIKEILPVILTVSGTYTGLQL
    USA300_FPR3757  FNLSGGVTTLDVARYSALTLPILNFIIPFVLVFIVDGMKGIKEILPVILTVSGTYTGLQL
                    ************************************************************

    COL             LLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLEASEHKIQKRTPKEIVFAWSPF
    N315            LLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLEASEHKIQKRTPKEIVFAWSPF
    NCTC8325        LLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLEASEHKIQKRTPKEIVFAWSPF
    Newman          LLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLEASEHKIQKRTPKEIVFAWSPF
    USA300_FPR3757  LLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLEASEHKIQKRTPKEIVFAWSPF
                    ************************************************************

    COL             VILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSDLSPKGIALRLDLIGATGTAI
    N315            VILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSDLSPKGIALRLDLIGATGTAI
    NCTC8325        VILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSDLSPKGIALRLDLIGATGTAI
    Newman          VILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSDLSPKGIALRLDLIGATGTAI
    USA300_FPR3757  VILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSDLSPKGIALRLDLIGATGTAI
                    ************************************************************

    COL             LLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAILAIAKVMTYGGLTVAIGQGIA
    N315            LLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAILAIAKVMTYGGLTVAIGQGIA
    NCTC8325        LLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAILAIAKVMTYGGLTVAIGQGIA
    Newman          LLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAILAIAKVMTYGGLTVAIGQGIA
    USA300_FPR3757  LLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAILAIAKVMTYGGLTVAIGQGIA
                    ************************************************************

    COL             KAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATVAQQISTSGSLLVAANTAGGVAA
    N315            KAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATVAQQISTSGSLLVAANTAGGVAA
    NCTC8325        KAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATVAQQISTSGSLLVAANTAGGVAA
    Newman          KAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATVAQQISTSGSLLVAANTAGGVAA
    USA300_FPR3757  KAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATVAQQISTSGSLLVAANTAGGVAA
                    ************************************************************

    COL             KLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVAFICVWTFILTLIF
    N315            KLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVAFICVWTFILTLIF
    NCTC8325        KLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVAFICVWTFILTLIF
    Newman          KLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVAFICVWTFILTLIF
    USA300_FPR3757  KLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVAFICVWTFILTLIF
                    **************************************************