From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000912000
  • symbol?: sirB
  • description?: lipoprotein

      descriptions from strain specific annotations:

    • lipoprotein
    • transport system permease protein
    • iron compound ABC transporter, permease protein SirB
    • Siderophore staphylobactin ABC transporter, permease protein SirB
    • achromobactin transport system permease protein cbrB
    • siderophore transport system permease
    • iron compound ABC transporter permease SirB
    • lipoprotein, SirB
    • siderophore compound ABC transporter permease SirB
    • iron (Fe3+) ABC transporter membrane protein
    • fecCD transport family protein
    • siderophore transport protein
    • iron-enterobactin transporter membrane protein
    • putative siderophore transport system permease
    • Staphylobactin transport system permease protein
    • siderophore ABC transporter permease
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, membrane protein
    • Iron compound ABC superfamily ATP binding cassette transporter, permease protein SirB
  • strand?: -
  • coordinates?: 1180634..1181629
  • synteny block?: BlockID0004490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0098 (sirB)
    N315:
    SA0110 (sirB)
    NCTC8325:
    Newman:
    NWMN_0058 (sirB)
    USA300_FPR3757:
    04-02981:
    SA2981_0115 (sirB)
    08BA02176:
    C248_0102 (sirB)
    11819-97:
    MS7_0106
    71193:
    ST398NM01_0125
    ECT-R 2:
    ECTR2_70
    ED133:
    SAOV_0061 (sirB)
    ED98:
    SAAV_0082 (sirB)
    HO 5096 0412:
    SAEMRSA15_00800 (sirB)
    JH1:
    SaurJH1_0105
    JH9:
    SaurJH9_0101
    JKD6008:
    SAA6008_00092 (sirB)
    JKD6159:
    SAA6159_00097 (sirB)
    LGA251:
    SARLGA251_00890 (sirB)
    M013:
    M013TW_0104
    MRSA252:
    SAR0117 (sirB)
    MSHR1132:
    SAMSHR1132_00900
    MSSA476:
    SAS0088
    Mu3:
    SAHV_0113 (sirB)
    Mu50:
    SAV0114 (sirB)
    MW2:
    MW0087 (sirB)
    RF122:
    SAB0053c (sirB)
    ST398:
    SAPIG0125
    T0131:
    SAT0131_00099 (mecA)
    TCH60:
    HMPREF0772_10383 (sirB)
    TW20:
    SATW20_01260 (sirB)
    USA300_TCH1516:
    USA300HOU_0125 (sirB)
    VC40:
    SAVC_00310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDSENDLHDVVTGARASR
    N315            MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDSENDLHDVVTGARASR
    NCTC8325        MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDSENDLHDVVTGARASR
    Newman          MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDSENDLHDVVTGARASR
    USA300_FPR3757  MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDSENDLHDVVTGARASR
                    ************************************************************

    COL             TIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIFSITFIQIQSFKMIVVI
    N315            TIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIFSITFIQIQSFKMIVVI
    NCTC8325        TIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIFSITFIQIQSFKMIVVI
    Newman          TIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIFSITFIQIQSFKMIVVI
    USA300_FPR3757  TIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIFSITFIQIQSFKMIVVI
                    ************************************************************

    COL             AFLGAIVVTVLVVALGMFRQTLFSPHRVILAGAAIAMLFTAFTQGILIMNETDLQGLLFW
    N315            AFLGAIVVTILVVALGMFRQTLFSPHRVILAGAAIAMLFTAFTQGILIMNETDLQGLLFW
    NCTC8325        AFLGAIVVTVLVVALGMFRQTLFSPHRVILAGAAIAMLFTAFTQGILIMNETDLQGLLFW
    Newman          AFLGAIVVTVLVVALGMFRQTLFSPHRVILAGAAIAMLFTAFTQGILIMNETDLQGLLFW
    USA300_FPR3757  AFLGAIVVTVLVVALGMFRQTLFSPHRVILAGAAIAMLFTAFTQGILIMNETDLQGLLFW
                    *********:**************************************************

    COL             LSGSVSLRNIWDITWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNIKLIKWMIIM
    N315            LSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNIKLIKWMIIM
    NCTC8325        LSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNIKLIKWMIIM
    Newman          LSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNIKLIKWMIIM
    USA300_FPR3757  LSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNIKLIKWMIIM
                    *************.**********************************************

    COL             LISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMIISDIVARII
    N315            LISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMIISDIVARII
    NCTC8325        LISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMIISDIVARII
    Newman          LISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMIISDIVARII
    USA300_FPR3757  LISMLAGISVAVAGSIVFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMIISDIVARII
                    ************************************************************

    COL             IKPLELPIGVVTAVIGAIVLIYIMKKGRQRL
    N315            IKPLELPIGVVTAVIGAIVLIYIMKKGRQRL
    NCTC8325        IKPLELPIGVVTAVIGAIVLIYIMKKGRQRL
    Newman          IKPLELPIGVVTAVIGAIVLIYIMKKGRQRL
    USA300_FPR3757  IKPLELPIGVVTAVIGAIVLIYIMKKGRQRL
                    *******************************