From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000914000
  • symbol?: sbnA
  • description?: cysteine synthase A protein

      descriptions from strain specific annotations:

    • cysteine synthase A protein
    • pyridoxal-5'-phosphate-dependent protein subunit beta
    • pyridoxal-5'-phosphate-dependent protein beta subunit
    • cysteine synthase/cystathionine beta-synthase family protein
    • Siderophore staphylobactin biosynthesis protein SbnA
    • cysteine synthase (O-acetylserine sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase)
    • pyridoxal-phosphate dependent protein
    • pyridoxal-phosphate dependent enzyme superfamily protein
    • O-Acetyl serine sulfhydrylase
    • 2,3-diaminopropionate biosynthesis protein SbnA
    • siderophore biosynthesis protein SbnA
  • strand?: +
  • coordinates?: 1182868..1183848
  • synteny block?: BlockID0004510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0060 (sbnA)
    USA300_FPR3757:
    04-02981:
    SA2981_0117 (sbnA)
    08BA02176:
    C248_0104
    11819-97:
    MS7_0108
    71193:
    ST398NM01_0127
    ECT-R 2:
    ECTR2_72
    ED133:
    SAOV_0063
    ED98:
    SAAV_0084
    HO 5096 0412:
    SAEMRSA15_00820 (sbnA)
    JH1:
    SaurJH1_0107
    JH9:
    SaurJH9_0103
    JKD6008:
    SAA6008_00094
    JKD6159:
    SAA6159_00099
    LGA251:
    SARLGA251_00910 (sbnA)
    M013:
    M013TW_0106
    MRSA252:
    SAR0119
    MSHR1132:
    SAMSHR1132_00920
    MSSA476:
    SAS0090
    Mu3:
    SAHV_0115
    Mu50:
    SAV0116
    MW2:
    MW0089
    RF122:
    SAB0055
    ST398:
    SAPIG0127
    T0131:
    SAT0131_00102 (gnd)
    TCH60:
    HMPREF0772_10381 (sbnA)
    TW20:
    SATW20_01280 (sbnA)
    USA300_TCH1516:
    USA300HOU_0127
    VC40:
    SAVC_00320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------MLDSVGQTPMVQLHQLFPKHEVFAKLEYMNPGGSMKDRPAKYIIEHGIK
    N315            MIEKSQACHDSLLDSVGQTPMVQLHQLFPKHEVFAKLEYMNPGGSMKDRPAKYIIEHGIK
    NCTC8325        ---------------------------------------------MKDRPAKYIIEHGIK
    Newman          MIEKSQACHDSLLDSVGQTPMVQLHQLFPKHEVFAKLEYMNPGGSMKDRPAKYIIEHGIK
    USA300_FPR3757  --------------------MVQLHQLFPKHEVFAKLEYMNPGGSMKDRPAKYIIEHGIK
                                                                 ***************

    COL             HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
    N315            HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
    NCTC8325        HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
    Newman          HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
    USA300_FPR3757  HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
                    ************************************************************

    COL             EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
    N315            EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
    NCTC8325        EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
    Newman          EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
    USA300_FPR3757  EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
                    ************************************************************

    COL             VAPVSTTGSIMGMSRKIKEVHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
    N315            VAPVSTTGSIMGMSRKIKEGHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
    NCTC8325        VAPVSTTGSIMGMSRKIKEVHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
    Newman          VAPVSTTGSIMGMSRKIKEVHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
    USA300_FPR3757  VAPVSTTGSIMGMSRKIKEVHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
                    ******************* ****************************************

    COL             SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
    N315            SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
    NCTC8325        SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
    Newman          SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
    USA300_FPR3757  SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
                    ************************************************************

    COL             GDRYLDLVYSDTWLEKMKSRQGVKSE
    N315            GDRYLDLVYSDTWLEKMKSRQGVKSE
    NCTC8325        GDRYLDLVYSDTWLEKMKSRQGVKSE
    Newman          GDRYLDLVYSDTWLEKMKSRQGVKSE
    USA300_FPR3757  GDRYLDLVYSDTWLEKMKSRQGVKSE
                    **************************