From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000921000
  • symbol?: sbnG
  • description?: siderophore biosynthesis protein SbnG

      descriptions from strain specific annotations:

    • siderophore biosynthesis protein SbnG
    • HPCH/HPAI aldolase
    • 2-dehydro-3-deoxyglucarate aldolase
    • HPCH/HPAI aldolase family protein
    • 4-hydroxy-2-oxovalerate aldolase
    • hpcH/HpaI aldolase/citrate lyase family protein
    • HpcH/HpaI family aldolase
    • putative aldolase
    • Siderophore staphylobactin biosynthesis protein SbnG
  • strand?: +
  • coordinates?: 1191348..1192127
  • synteny block?: BlockID0004580
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0066 (sbnG)
    USA300_FPR3757:
    04-02981:
    SA2981_0123 (sbnG)
    08BA02176:
    C248_0110
    11819-97:
    MS7_0114
    71193:
    ST398NM01_0134
    ECT-R 2:
    ECTR2_78
    ED133:
    SAOV_0069
    ED98:
    SAAV_0090
    HO 5096 0412:
    SAEMRSA15_00880
    JH1:
    SaurJH1_0113
    JH9:
    SaurJH9_0109
    JKD6008:
    SAA6008_00100
    JKD6159:
    SAA6159_00105
    LGA251:
    SARLGA251_00970 (sbnG)
    M013:
    M013TW_0112
    MRSA252:
    SAR0125
    MSHR1132:
    SAMSHR1132_00980
    MSSA476:
    SAS0096
    Mu3:
    SAHV_0121
    Mu50:
    SAV0122
    MW2:
    MW0095
    RF122:
    SAB0061
    ST398:
    SAPIG0134
    T0131:
    SAT0131_00108
    TCH60:
    HMPREF0772_10375 (sbnG)
    TW20:
    SATW20_01340 (sbnG)
    USA300_TCH1516:
    USA300HOU_0133
    VC40:
    SAVC_00350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIR
    N315            MMQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIR
    NCTC8325        -MQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIR
    Newman          MMQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIR
    USA300_FPR3757  -MQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTEHVAINDETLAHLIR
                     ***********************************************************

    COL             AAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSL
    N315            AAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSL
    NCTC8325        AAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSL
    Newman          AAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSL
    USA300_FPR3757  AAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEHIVKLSRYYPQGLRSL
                    ************************************************************

    COL             NGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQVEGLDMIVEGAADLSQ
    N315            NGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQVEGLDMIVEGAADLSQ
    NCTC8325        NGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQVEGLDMIVEGAADLSQ
    Newman          NGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQVEGLDMIVEGAADLSQ
    USA300_FPR3757  NGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQVEGLDMIVEGAADLSQ
                    ************************************************************

    COL             SLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK
    N315            SLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK
    NCTC8325        SLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK
    Newman          SLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK
    USA300_FPR3757  SLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAKWQAQGVQTFILGDDRGK
                    ************************************************************

    COL             IYRHLSASLATSKQKGDEG
    N315            IYRHLSASLATSKQKGDDG
    NCTC8325        IYRHLSASLATSKQKGDEG
    Newman          IYRHLSASLATSKQKGDEG
    USA300_FPR3757  IYRHLSASLATSKQKGDEG
                    *****************:*