From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000923000
  • symbol?: sbnI
  • description?: nuclease

      descriptions from strain specific annotations:

    • nuclease
    • parB-like nuclease domain protein
    • Siderophore staphylobactin biosynthesis protein SbnI
    • ParB domain-containing protein nuclease
  • strand?: +
  • coordinates?: 1193333..1194097
  • synteny block?: BlockID0004600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0068 (sbnI)
    USA300_FPR3757:
    04-02981:
    SA2981_0125 (sbnI)
    08BA02176:
    C248_0112
    11819-97:
    MS7_0116
    71193:
    ST398NM01_0136
    ECT-R 2:
    ECTR2_80
    ED133:
    SAOV_0071
    ED98:
    SAAV_0092
    HO 5096 0412:
    SAEMRSA15_00900
    JH1:
    SaurJH1_0115
    JH9:
    SaurJH9_0111
    JKD6008:
    SAA6008_00102 (sbnl)
    JKD6159:
    SAA6159_00107 (sbnl)
    LGA251:
    SARLGA251_00990 (sbnI)
    M013:
    M013TW_0114
    MRSA252:
    SAR0127
    MSHR1132:
    SAMSHR1132_01000
    MSSA476:
    SAS0098
    Mu3:
    SAHV_0123
    Mu50:
    SAV0124
    MW2:
    MW0097
    RF122:
    SAB0063
    ST398:
    SAPIG0136
    T0131:
    SAT0131_00110 (lpdA)
    TCH60:
    HMPREF0772_10373
    TW20:
    SATW20_01360 (sbnI)
    USA300_TCH1516:
    USA300HOU_0135
    VC40:
    SAVC_00360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPILVTAMQHGRYMVIDGV
    N315            MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPILVTAMQHGRYMVIDGV
    NCTC8325        MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPILVTAMQHGRYMVIDGV
    Newman          MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPILVTAMQHGRYMVIDGV
    USA300_FPR3757  MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPILVTAMQHGRYMVIDGV
                    ************************************************************

    COL             HRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQEHRLPWTTETRQEAPF
    N315            HRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQEHRLPWTTETRQEAPF
    NCTC8325        HRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQEHRLPWTTETRQEAPF
    Newman          HRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQEHRLPWTTETRQEAPF
    USA300_FPR3757  HRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQEHRLPWTTETRQEAPF
                    ************************************************************

    COL             ITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQGTYPCLSQQDVLMKYQP
    N315            ITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQGTYPCLSQQDVLMKYQP
    NCTC8325        ITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQGTYPCLSQQDVLMKYQP
    Newman          ITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQGTYPCLSQQDVLMKYQP
    USA300_FPR3757  ITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQGTYPCLSQQDVLMKYQP
                    ************************************************************

    COL             LSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQDDDVEQLRNWKQFLADKFA
    N315            LSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQDDDVEQLRNWKQFLADKFA
    NCTC8325        LSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQDDDVEQLRNWKQFLADKFA
    Newman          LSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQDDDVEQLRNWKQFLADKFA
    USA300_FPR3757  LSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQDDDVEQLRNWKQFLADKFA
                    ************************************************************

    COL             NMRCYTEKVYLVEQ
    N315            NMRCYTEKVYLVEQ
    NCTC8325        NMRCYTEKVYLVEQ
    Newman          NMRCYTEKVYLVEQ
    USA300_FPR3757  NMRCYTEKVYLVEQ
                    **************