From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000940000
  • symbol?:
  • description?: ligase

      descriptions from strain specific annotations:

    • ligase
    • O-Antigen ligase family protein
    • O-antigen polymerase
    • O-Antigen Polymerase family protein
    • Secreted polysaccharide polymerase
    • Teichuronic acid biosynthesis protein TuaE,putative secreted polysaccharide polymerase
  • strand?: +
  • coordinates?: 1200494..1201732
  • synteny block?: BlockID0004760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0132
    08BA02176:
    C248_0120
    11819-97:
    MS7_0122
    71193:
    ST398NM01_0145
    ECT-R 2:
    ECTR2_87
    ED133:
    SAOV_0079
    ED98:
    SAAV_0099
    HO 5096 0412:
    SAEMRSA15_00980
    JH1:
    SaurJH1_0122
    JH9:
    SaurJH9_0117
    JKD6008:
    SAA6008_00109
    JKD6159:
    SAA6159_00114
    LGA251:
    SARLGA251_01060
    M013:
    M013TW_0121
    MRSA252:
    SAR0133
    MSHR1132:
    SAMSHR1132_01070
    MSSA476:
    SAS0105
    Mu3:
    SAHV_0130
    Mu50:
    SAV0131
    MW2:
    MW0105
    RF122:
    SAB0070 (cps2H)
    ST398:
    SAPIG0145
    T0131:
    SAT0131_00119 (nusB)
    TCH60:
    HMPREF0772_10367 (cps2H)
    TW20:
    SATW20_01420
    USA300_TCH1516:
    USA300HOU_0143
    VC40:
    SAVC_00395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVYLLFFANHLLKANHFL
    N315            MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVYLLFFANHLLKANHFL
    NCTC8325        MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVYLLFFANHLLKANHFL
    Newman          MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVYLLFFANHLLKANHFL
    USA300_FPR3757  MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVYLLFFANHLLKANHFL
                    ************************************************************

    COL             QFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIYFYLGMIIFKLGNSKKV
    N315            QFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIYFYLGMIIFKLGNSKKV
    NCTC8325        QFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIYFYLGMIIFKLGNSKKV
    Newman          QFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIYFYLGMIIFKLGNSKKV
    USA300_FPR3757  QFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIYFYLGMIIFKLGNSKKV
                    ************************************************************

    COL             IVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMNDPNYFAMTQIITLVLAY
    N315            IVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMNDPNYFAMTQIITLVLAY
    NCTC8325        IVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMNDPNYFAMTQIITLVLAY
    Newman          IVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMNDPNYFAMTQIITLVLAY
    USA300_FPR3757  IVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMNDPNYFAMTQIITLVLAY
                    ************************************************************

    COL             KYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIKKLFSRNAVSVVSMSVIML
    N315            KYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIKKLFSRNAVSVVSMLVIML
    NCTC8325        KYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIKKLFSRNAVSVVSMSVIML
    Newman          KYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIKKLFSRNAVSVVSMSVIML
    USA300_FPR3757  KYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIKKLFSRNAVSVVSMSVIML
                    ******************************************************* ****

    COL             ILLCFTFYNINYYLFQLSDLDALPSLDRMAPIFEEGFASLNDSGSERSVVWINAISVIKY
    N315            ILLCFTFYNINYYLFQLSDLDAVPSLDRMASIFEEGFASLNDSGSERSVVWINAILVIKY
    NCTC8325        ILLCFTFYNINYYLFQLSDLDALPSLDRMASIFEEGFASLNDSGSERSVVWINAISVIKY
    Newman          ILLCFTFYNINYYLFQLSDLDALPSLDRMASIFEEGFASLNDSGSERSVVWINAISVIKY
    USA300_FPR3757  ILLCFTFYNINYYLFQLSDLDALPSLDRMASIFEEGFASLNDSGSERSVVWINAISVIKY
                    **********************:*******.************************ ****

    COL             TLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFAEWGILFGALFIIFMLYLLFELFRFNI
    N315            TLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFAEWGILFGALFIIFMLYLLFELFRFNI
    NCTC8325        TLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFAEWGILFGALFIIFMLYLLFELFRFNI
    Newman          TLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFAEWGILFGALFIIFMLYLLFELFRFNI
    USA300_FPR3757  TLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFAEWGILFGALFIIFMLYLLFELFRFNI
                    ************************************************************

    COL             SGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFIVQYEKMERDRNEE
    N315            SGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFIVQYEKMERDRNEE
    NCTC8325        SGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFIVQYEKMERDRNEE
    Newman          SGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFIVQYEKMERDRNEE
    USA300_FPR3757  SGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFIVQYEKMERDRNEE
                    ****************************************************