From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000941000
  • symbol?:
  • description?: polysaccharide extrusion protein

      descriptions from strain specific annotations:

    • polysaccharide extrusion protein
    • AmrA
    • lipopolysaccharide flipase protein
    • Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids
    • MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide flippase transporter
    • polysaccharide biosynthesis family protein
    • polysaccharide biosynthesis protein
  • strand?: +
  • coordinates?: 1201689..1203152
  • synteny block?: BlockID0004770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0133
    08BA02176:
    C248_0121
    11819-97:
    MS7_0123
    71193:
    ST398NM01_0146
    ECT-R 2:
    ECTR2_88
    ED133:
    SAOV_0080
    ED98:
    SAAV_0100
    HO 5096 0412:
    SAEMRSA15_00990
    JH1:
    SaurJH1_0123
    JH9:
    SaurJH9_0118
    JKD6008:
    SAA6008_00110
    JKD6159:
    SAA6159_00115
    LGA251:
    SARLGA251_01070
    M013:
    M013TW_0122
    MRSA252:
    SAR0134
    MSHR1132:
    SAMSHR1132_01080
    MSSA476:
    SAS0106
    Mu3:
    SAHV_0131
    Mu50:
    SAV0132
    MW2:
    MW0106
    RF122:
    SAB0071
    ST398:
    SAPIG0146
    T0131:
    SAT0131_00120
    TCH60:
    HMPREF0772_10366
    TW20:
    SATW20_01430
    USA300_TCH1516:
    USA300HOU_0144
    VC40:
    SAVC_00400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSFSFNIVQYFLMIASVG
    N315            MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSFSFNIVQYFLMIASVG
    NCTC8325        MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSFSFNIVQYFLMIASVG
    Newman          MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSFSFNIVQYFLMIASVG
    USA300_FPR3757  MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSFSFNIVQYFLMIASVG
                    ************************************************************

    COL             VQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVVITIFIDDYYLIFLLQG
    N315            VQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVVITIFIDDYYLIFLLQG
    NCTC8325        VQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVVITIFIDDYYLIFLLQG
    Newman          VQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVVITIFIDDYYLIFLLQG
    USA300_FPR3757  VQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVVITIFIDDYYLIFLLQG
                    ************************************************************

    COL             IYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVKDQSDLSLYVFTIAIVTV
    N315            IYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVKDQSDLSLYVFTIAIVTV
    NCTC8325        IYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVKDQSDLSLYVFTIAIVTV
    Newman          IYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVKDQSDLSLYVFTIAIVTV
    USA300_FPR3757  IYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVKDQSDLSLYVFTIAIVTV
                    ************************************************************

    COL             LNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLNLYTSISCVVLGLVGTYQQ
    N315            LNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLNLYTSISCVVLGLVGTYQQ
    NCTC8325        LNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLNLYTSISCVVLGLVGTYQQ
    Newman          LNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLNLYTSISCVVLGLVGTYQQ
    USA300_FPR3757  LNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLNLYTSISCVVLGLVGTYQQ
                    ************************************************************

    COL             VGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLTKTLANNMNIQLILTIPMVF
    N315            VGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLTKTLANNMNIQLILTIPMVF
    NCTC8325        VGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLTKTLANNMNIQLILTIPMVF
    Newman          VGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLTKTLANNMNIQLILTIPMVF
    USA300_FPR3757  VGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLTKTLANNMNIQLILTIPMVF
                    ************************************************************

    COL             GLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNMLISRQYLLIVNKIRLYNASIT
    N315            GLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNMLISRQYLLIVNKIRLYNASIT
    NCTC8325        GLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNMLISRQYLLIVNKIRLYNASIT
    Newman          GLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNMLISRQYLLIVNKIRLYNASIT
    USA300_FPR3757  GLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNMLISRQYLLIVNKIRLYNASIT
                    ************************************************************

    COL             IGAVINLVLCIILIYFYGIYGAAIARLITEFFLLIWRFIDITKINVKLNIVSTIQCVIAA
    N315            IGAVMNLVLCLVLIYFYGIYGAAIARLITEFILLIWRFVDITKINVKLNIVSTIQCVIAA
    NCTC8325        IGAVINLVLCIILIYFYGIYGAAIARLITEFFLLIWRFIDITKINVKLNIVSTIQCVIAA
    Newman          IGAVINLVLCIILIYFYGIYGAAIARLITEFFLLIWRFIDITKINVKLNIVSTIQCVIAA
    USA300_FPR3757  IGAVINLVLCIILIYFYGIYGAAIARLITEFFLLIWRFIDITKINVKLNIVSTIQCVIAA
                    ****:*****::*******************:******:*********************

    COL             VMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMTMKNQYVWQILRHLRHKTI
    N315            VMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMTMKNQYVWQILRHLRHKTI
    NCTC8325        VMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMTMKNQYVWQILRHLRHKTI
    Newman          VMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMTMKNQYVWQILRHLRHKTI
    USA300_FPR3757  VMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMTMKNQYVWQILRHLRHKTI
                    ********************************************************