Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000942000
  • symbol?: sodM
  • description?: superoxide dismutase

      descriptions from strain specific annotations:

    • superoxide dismutase
    • Manganese superoxide dismutase
    • Superoxide dismutase (Fe)
    • superoxide dismutase [Mn] (General stress protein 24)(GSP24)
    • Fe/Mn family superoxide dismutase
    • superoxide dismutase [Mn/Fe] 2
    • Superoxide dismutase (Mn/Fe family)
    • Manganese superoxide dismutase, Superoxide dismutase
    • manganese/iron superoxide dismutase
  • strand?: +
  • coordinates?: 1203434..1203997
  • synteny block?: BlockID0004780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0118 (sodA1)
    N315:
    SA0128 (sodM)
    NCTC8325:
    Newman:
    NWMN_0077 (sodM)
    USA300_FPR3757:
    04-02981:
    SA2981_0134 (sodM)
    08BA02176:
    C248_0122 (sodM)
    11819-97:
    MS7_0124 (sodM)
    71193:
    ST398NM01_0147
    ECT-R 2:
    ECTR2_89
    ED133:
    SAOV_0081 (sodA)
    ED98:
    SAAV_0101 (sodA1)
    HO 5096 0412:
    SAEMRSA15_01000 (sodM)
    JH1:
    SaurJH1_0124
    JH9:
    SaurJH9_0119
    JKD6008:
    SAA6008_00111 (sodM)
    JKD6159:
    SAA6159_00116 (sodM)
    LGA251:
    SARLGA251_01080 (sodM)
    M013:
    M013TW_0123
    MRSA252:
    SAR0135 (sodM)
    MSHR1132:
    SAMSHR1132_01090
    MSSA476:
    SAS0107
    Mu3:
    SAHV_0132 (sodM)
    Mu50:
    SAV0133 (sodM)
    MW2:
    MW0107 (sodM)
    RF122:
    SAB0072 (sodM)
    ST398:
    SAPIG0147
    T0131:
    SAT0131_00121
    TCH60:
    HMPREF0772_10365 (sodA)
    TW20:
    SATW20_01440 (sodM)
    USA300_TCH1516:
    USA300HOU_0145 (sodM)
    VC40:
    SAVC_00405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL
    N315            MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL
    NCTC8325        MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL
    Newman          MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL
    USA300_FPR3757  MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANL
                    ************************************************************

    COL             DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKA
    N315            DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKA
    NCTC8325        DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKA
    Newman          DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKA
    USA300_FPR3757  DKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKA
                    ************************************************************

    COL             TTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMT
    N315            TTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMT
    NCTC8325        TTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMT
    Newman          TTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMT
    USA300_FPR3757  TTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMT
                    ************************************************************

    COL             AFWNIVNWKKVDELYQAAK
    N315            AFWNIVNWKKVDELYQAAK
    NCTC8325        AFWNIVNWKKVDELYQAAK
    Newman          AFWNIVNWKKVDELYQAAK
    USA300_FPR3757  AFWNIVNWKKVDELYQAAK
                    *******************