From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000956000
  • symbol?: phnC
  • description?: phosphonates import ATP-binding protein PhnC

      descriptions from strain specific annotations:

    • phosphonates import ATP-binding protein PhnC
    • phosphonate ABC transporter ATP-binding protein
    • amino acid ABC transporter ATP-binding protein
    • ABC transport ATP-binding protein
    • ABC transporter ATP binding protein
    • PhnC protein
    • phosphonate ABC superfamily ATP binding cassette transporter, ABC protein
    • phosphonate ABC transporter, ATP-binding protein
    • phosphonate ABC transporter ATPase
    • putative ABC transport ATP-binding protein
    • transport system protein
  • strand?: -
  • coordinates?: 1215686..1216459
  • synteny block?: BlockID0004910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0143
    08BA02176:
    C248_0131
    11819-97:
    MS7_0133 (phnC)
    71193:
    ST398NM01_0156
    ECT-R 2:
    ECTR2_98 (phnC)
    ED133:
    SAOV_0089
    ED98:
    SAAV_0110
    HO 5096 0412:
    SAEMRSA15_01080
    JH1:
    SaurJH1_0133
    JH9:
    SaurJH9_0128
    JKD6008:
    SAA6008_00120 (phnC)
    JKD6159:
    SAA6159_00125 (phnC)
    LGA251:
    SARLGA251_01160
    M013:
    M013TW_0132
    MRSA252:
    SAR0144
    MSHR1132:
    SAMSHR1132_01180
    MSSA476:
    SAS0116
    Mu3:
    SAHV_0141
    Mu50:
    SAV0142
    MW2:
    MW0116
    RF122:
    SAB0083c
    ST398:
    SAPIG0156 (phnC)
    T0131:
    SAT0131_00131
    TCH60:
    HMPREF0772_10356 (phnC)
    TW20:
    SATW20_01530
    USA300_TCH1516:
    USA300HOU_0154
    VC40:
    SAVC_00455

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGE
    N315            MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGE
    NCTC8325        MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGE
    Newman          MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGE
    USA300_FPR3757  MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGE
                    ************************************************************

    COL             IFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLF
    N315            IFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLF
    NCTC8325        IFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLF
    Newman          IFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLF
    USA300_FPR3757  IFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLF
                    ************************************************************

    COL             PKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDP
    N315            PKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDP
    NCTC8325        PKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDP
    Newman          PKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDP
    USA300_FPR3757  PKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDP
                    ************************************************************

    COL             LTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVF
    N315            LTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVF
    NCTC8325        LTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVF
    Newman          LTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVF
    USA300_FPR3757  LTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVF
                    ************************************************************

    COL             SEIYGRTIKEDEKLGVN
    N315            SEIYGRTIKEDEKLGVN
    NCTC8325        SEIYGRTIKEDEKLGVN
    Newman          SEIYGRTIKEDEKLGVN
    USA300_FPR3757  SEIYGRTIKEDEKLGVN
                    *****************