From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000958000
  • symbol?:
  • description?: putative ABC-type transporter

      descriptions from strain specific annotations:

    • putative ABC-type transporter
    • PPE-repeat protein
  • strand?: +
  • coordinates?: 1217862..1219406
  • synteny block?: BlockID0004930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0145
    08BA02176:
    C248_0133
    11819-97:
    MS7_0135
    71193:
    ST398NM01_0158
    ECT-R 2:
    ECTR2_100
    ED133:
    SAOV_0091
    ED98:
    SAAV_0112
    HO 5096 0412:
    SAEMRSA15_01100
    JH1:
    SaurJH1_0135
    JH9:
    SaurJH9_0130
    JKD6008:
    SAA6008_00122
    JKD6159:
    SAA6159_00127
    LGA251:
    SARLGA251_01180
    M013:
    M013TW_0134
    MRSA252:
    SAR0146
    MSHR1132:
    SAMSHR1132_01200
    MSSA476:
    SAS0118
    Mu3:
    SAHV_0143
    Mu50:
    SAV0144
    MW2:
    MW0118
    RF122:
    SAB0085
    ST398:
    SAPIG0158
    T0131:
    SAT0131_00133
    TCH60:
    HMPREF0772_10354
    TW20:
    SATW20_01550
    USA300_TCH1516:
    USA300HOU_0156
    VC40:
    SAVC_00465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDRSHGQTAGAADWVSDG
    N315            MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDRSHGQTAGAADWVSDG
    NCTC8325        MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDRSHGQTAGAADWVSDG
    Newman          MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDRSHGQTAGAADWVSDG
    USA300_FPR3757  MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDRSHGQTAGAADWVSDG
                    ************************************************************

    COL             AFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIPFKESEQAAIVKYVKQG
    N315            AFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIPFKESEQAAIVNYVKQG
    NCTC8325        AFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIPFKESEQAAIVKYVKQG
    Newman          AFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIPFKESEQAAIVKYVKQG
    USA300_FPR3757  AFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIPFKESEQAAIVKYVKQG
                    ******************************************************:*****

    COL             GNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAEEKSSTAMQGVKSSDWLS
    N315            GNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAEEKSSTAMQGVKSSDWLS
    NCTC8325        GNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAEEKSSTAMQGVKSSDWLS
    Newman          GNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAEEKSSTAMQGVKSSDWLS
    USA300_FPR3757  GNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAEEKSSTAMQGVKSSDWLS
                    ************************************************************

    COL             TNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGSTLAITNPEKAKGIVYTPE
    N315            TNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGSTLAITNPEKAKGIVYTPE
    NCTC8325        TNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGSTLAITNPEKAKGIVYTPE
    Newman          TNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGSTLAITNPEKAKGIVYTPE
    USA300_FPR3757  TNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGSTLAITNPEKAKGIVYTPE
                    ************************************************************

    COL             QLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFIGDSSLVEDSSPKYVREDNG
    N315            QLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFIGDSSLVEDSSPKYVREDNG
    NCTC8325        QLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFIGDSSLVEDSSPKYVREDNG
    Newman          QLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFIGDSSLVEDSSPKYVREDNG
    USA300_FPR3757  QLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFIGDSSLVEDSSPKYVREDNG
                    ************************************************************

    COL             EKKKTYDGFKEQDNGKLLNNITAWMSKDNDGKSLKASSLTLDTKTKLLDFERPERSTEPE
    N315            EKKKTYDGFKEQDNGKLLNNITAWMSKDSDGKSLKASGLTLDTKTKLLDFERPERSTEPE
    NCTC8325        EKKKTYDGFKEQDNGKLLNNITAWMSKDNDGKSLKASSLTLDTKTKLLDFERPERSTEPE
    Newman          EKKKTYDGFKEQDNGKLLNNITAWMSKDNDGKSLKASSLTLDTKTKLLDFERPERSTEPE
    USA300_FPR3757  EKKKTYDGFKEQDNGKLLNNITAWMSKDNDGKSLKASSLTLDTKTKLLDFERPERSTEPE
                    ****************************.********.**********************

    COL             KEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDDHTPPNQNEKVTFDIPQNVSVN
    N315            KEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDDHTPPNQNVKISFDIPQNVSVN
    NCTC8325        KEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDDHTPPNQNEKVTFDIPQNVSVN
    Newman          KEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDDHTPPNQNEKVTFDIPQNVSVN
    USA300_FPR3757  KEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDDHTPPNQNEKVTFDIPQNVSVN
                    ********************************************** *::**********

    COL             EPFEMTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSSKDNDYNPPGYSTLPTVKADENG
    N315            EPFEVTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSSKDNDYNPPGYSTLPTVKADENG
    NCTC8325        EPFEMTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSSKDNDYNPPGYSTLPTVKADENG
    Newman          EPFEMTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSSKDNDYNPPGYSTLPTVKADENG
    USA300_FPR3757  EPFEMTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSSKDNDYNPPGYSTLPTVKADENG
                    ****:*******************************************************

    COL             NVTIKVNAKVLESMEGSKIRLKLGDKTLITTDFK
    N315            NATIKINAKVLESMEGSKIRLKLGDKTLITTDFK
    NCTC8325        NVTIKVNAKVLESMEGSKIRLKLGDKTLITTDFK
    Newman          NVTIKVNAKVLESMEGSKIRLKLGDKTLITTDFK
    USA300_FPR3757  NVTIKVNAKVLESMEGSKIRLKLGDKTLITTDFK
                    *.***:****************************