From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000979000
  • symbol?: capE
  • description?: capsular polysaccharide synthesis protein Cap8E

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap8E
    • capsular polysaccharide synthesis enzyme Cap8E
    • polysaccharide biosynthesis protein CapD
    • capsular polysaccharide biosynthesis protein Cap5E
    • CJ1293
    • capsular polysaccharide biosynthesis protein CapE
    • polysaccharide biosynthesis family protein
    • UDP-glucose 4-epimerase
    • capsular polysaccharide synthesis enzyme CapE
    • UDP-2-acetamido-2,6-dideoxy-alpha-D-xylo-4-hexulose 3,5-epimerase
  • strand?: +
  • coordinates?: 1234504..1235622
  • synteny block?: BlockID0005130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0140 (cap5E)
    N315:
    SA0148 (capE)
    NCTC8325:
    Newman:
    NWMN_0099 (capE)
    USA300_FPR3757:
    SAUSA300_0156 (cap5E)
    04-02981:
    SA2981_0154 (capE)
    08BA02176:
    C248_0142 (capE)
    11819-97:
    MS7_0147
    71193:
    ST398NM01_0167
    ECT-R 2:
    ECTR2_110
    ED133:
    SAOV_0100
    ED98:
    SAAV_0121 (cap5E)
    HO 5096 0412:
    SAEMRSA15_01190 (capE)
    JH1:
    SaurJH1_0144
    JH9:
    SaurJH9_0139
    JKD6008:
    SAA6008_00131 (cap5E)
    JKD6159:
    SAA6159_00137 (cap5E)
    LGA251:
    SARLGA251_01270 (capE)
    M013:
    M013TW_0143
    MRSA252:
    SAR0155 (capE)
    MSHR1132:
    SAMSHR1132_01270
    MSSA476:
    SAS0128
    Mu3:
    SAHV_0152 (capE)
    Mu50:
    SAV0153 (capE)
    MW2:
    MW0128 (cap8E)
    RF122:
    SAB0094 (capE)
    ST398:
    SAPIG0167
    T0131:
    SAT0131_00143
    TCH60:
    HMPREF0772_10345 (galE)
    TW20:
    SATW20_01640 (capE)
    USA300_TCH1516:
    USA300HOU_0167 (cap5E)
    VC40:
    SAVC_00535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFDDKILLITGGTGSFGNAVMKQFLDSNIKEIRIFSRDEKKQDDIRKKYNNSKLKFYIGD
    N315            MFDDKILLITGGTGSFGNAVMKRFLDSNIKEIRIFSRDEKKQDDIRKKYNNSKLKFYIGD
    NCTC8325        MFDDKILLITGGTGSFGNAVMKQFLDSNIKEIRIFSRDEKKQDDIRKKYNNSKLKFYIGD
    Newman          MFDDKILLITGGTGSFGNAVMKQFLDSNIKEIRIFSRDEKKQDDIRKKYNNSKLKFYIGD
    USA300_FPR3757  MFDDKILLITGGTGSFGNAVMKQFLDSNIKEIRIFSRDEKKQDDIRKKYNNSKLKFYIGD
                    **********************:*************************************

    COL             VRDSQSVETAMRDVDYVFHAAALKQVPSCEFFPVEAVKTNIIGTENVLQSAIHQNVKKVI
    N315            VRDSQSVETAMRDVDYVFHAAALKQVPSCEFFPVEAVKTNIIGTENVLQSAIHQNVKKVI
    NCTC8325        VRDSQSVETAMRDVDYVFHAAALKQVPSCEFFPVEAVKTNIIGTENVLQSAIHQNVKKVI
    Newman          VRDSQSVETAMRDVDYVFHAAALKQVPSCEFFPVEAVKTNIIGTENVLQSAIHQNVKKVI
    USA300_FPR3757  VRDSQSVETAMRDVYYVFHAAALKQVPSCEFFPVEAVKTNIIGTENVLQSAIHQNVKKVI
                    ************** *********************************************

    COL             CLSTDKAAYPINAMGISKAMMEKVFVAKSRNIRSEQTLICGTRYGNVMASRGSVIPLFID
    N315            CLSTDKAAYPINAMGISKAMMEKVFVAKSRNIRSEQTLICGTRYGNVMASRGSVIPLFID
    NCTC8325        CLSTDKAAYPINARGISKAMMEKVFVAKSRNIRSEQTLICGTRYGNVMASRGSVIPLFID
    Newman          CLSTDKAAYPINAMGISKAMMEKVFVAKSRNIRSEQTLICGTRYGNVMASRGSVIPLFID
    USA300_FPR3757  CLSTDKAAYPINAMGISKAMMEKVFVAKSRNIRSEQTLICGTRYGNVMASRGSVIPLFID
                    ************* **********************************************

    COL             KIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIMVQKAPSSTVGDLATALLE
    N315            KIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIMVQKAPSSTVGDLATALLE
    NCTC8325        KIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIMVQKAPSSTVGDLATALLE
    Newman          KIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIMVQKAPSSTVGDLATALLE
    USA300_FPR3757  KIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIMVQKAPSSTVGDLATALLE
                    ************************************************************

    COL             LFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRVPADSRDLNYSNYVETGNEK
    N315            LFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRVPADSRDLNYSNYVETGNEK
    NCTC8325        LFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRVPADSRDLNYSNYVETGNEK
    Newman          LFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRVPADSRDLNYSNYVETGNEK
    USA300_FPR3757  LFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRVPADSRDLNYSNYVETGNEK
                    ************************************************************

    COL             ITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKASMR
    N315            ITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKASMR
    NCTC8325        ITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKASMR
    Newman          ITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKASMR
    USA300_FPR3757  ITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKASMR
                    ******************************************