From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000980000
  • symbol?: capF
  • description?: capsular polysaccharide synthesis protein Cap5F

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap5F
    • capsular polysaccharide synthesis enzyme Cap5F
    • NAD-dependent epimerase/dehydratase
    • Capsular polysaccharide synthesis enzyme Cap8F
    • NAD dependent epimerase/dehydratase family protein
    • capsular polysaccharide biosynthesis protein Cap5F
    • capsular polysaccharide biosynthesis protein Cap8F
    • capsular polysaccharide synthesis enzyme CapF
    • UDP-2-acetamido-2,6-dideoxy-beta-L-talose 4-dehydrogenase
  • strand?: +
  • coordinates?: 1235629..1236744
  • synteny block?: BlockID0005140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0141 (cap5F)
    N315:
    SA0149 (capF)
    NCTC8325:
    Newman:
    NWMN_0100 (capF)
    USA300_FPR3757:
    SAUSA300_0157 (cap5F)
    04-02981:
    SA2981_0155 (capF)
    08BA02176:
    C248_0143 (capF)
    11819-97:
    MS7_0148 (capF)
    71193:
    ST398NM01_0168
    ECT-R 2:
    ECTR2_111
    ED133:
    SAOV_0101
    ED98:
    SAAV_0122 (cap5F)
    HO 5096 0412:
    SAEMRSA15_01200 (capF)
    JH1:
    SaurJH1_0145
    JH9:
    SaurJH9_0140
    JKD6008:
    SAA6008_00132 (cap5F)
    JKD6159:
    SAA6159_00138 (cap5F)
    LGA251:
    SARLGA251_01280 (capF)
    M013:
    M013TW_0144
    MRSA252:
    SAR0156 (capF)
    MSHR1132:
    SAMSHR1132_01280
    MSSA476:
    SAS0129
    Mu3:
    SAHV_0153 (capF)
    Mu50:
    SAV0154 (capF)
    MW2:
    MW0129 (cap8F)
    RF122:
    SAB0095 (capF)
    ST398:
    SAPIG0168
    T0131:
    SAT0131_00144
    TCH60:
    HMPREF0772_10344 (cap5F)
    TW20:
    SATW20_01650 (capF)
    USA300_TCH1516:
    USA300HOU_0168 (cap5F)
    VC40:
    SAVC_00540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALLKADFVVHLAGVNRPE
    N315            MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALLKADFIVHLAGVNRPE
    NCTC8325        MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALLKADFVVHLAGVNRPE
    Newman          MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALLKADFVVHLAGVNRPE
    USA300_FPR3757  MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALLKADFVVHLAGVNRPE
                    *************************************************:**********

    COL             HDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYGESKLQGEQLLREYAEE
    N315            HDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYGESKLQGEQLLREYAEE
    NCTC8325        HDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYGESKLQGEQLLREYAEE
    Newman          HDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYGESKLQGEQLLREYAEE
    USA300_FPR3757  HDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYGESKLQGEQLLREYAEE
                    ************************************************************

    COL             YGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVNDRNVELTLNYVDDIVAEI
    N315            YGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVNDRNVELTLNYVDDIVAEI
    NCTC8325        YGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVNDRNVELTLNYVDDIVAEI
    Newman          YGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVNDRNVELTLNYVDDIVAEI
    USA300_FPR3757  YGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVNDRNVELTLNYVDDIVAEI
                    ************************************************************

    COL             KRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDRTLPKLDNLFEKDLYSTYL
    N315            KRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDRTLPKLDNLFEKDLYSTYL
    NCTC8325        KRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDRTLPKLDNLFEKDLYSTYL
    Newman          KRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDRTLPKLDNLFEKDLYSTYL
    USA300_FPR3757  KRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDRTLPKLDNLFEKDLYSTYL
                    ************************************************************

    COL             SYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKPGITKGNHWHHTKNEKFLVV
    N315            SYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKPGITKGNHWHHTKNEKFLVV
    NCTC8325        SYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKPGITKGNHWHHTKNEKFLVV
    Newman          SYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKPGITKGNHWHHTKNEKFLVV
    USA300_FPR3757  SYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKPGITKGNHWHHTKNEKFLVV
                    ************************************************************

    COL             SGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIENLGDTDMVTIMWVNEMFDPN
    N315            SGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIENLGDTDMVTIMWVNEMFDPN
    NCTC8325        SGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIENLGDTDMVTIMWVNEMFDPN
    Newman          SGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIENLGDTDMVTIMWVNEMFDPN
    USA300_FPR3757  SGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIENLGDTDMVTIMWVNEMFDPN
                    ************************************************************

    COL             QPDTYFLEV
    N315            QPDTYFLEV
    NCTC8325        QPDTYFLEV
    Newman          QPDTYFLEV
    USA300_FPR3757  QPDTYFLEV
                    *********