From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000981000
  • symbol?: capG
  • description?: UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)

      descriptions from strain specific annotations:

    • UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)
    • UDP-N-acetylglucosamine 2-epimerase Cap5G
    • capsular polysaccharide synthesis protein Cap5G
    • UDP-N-acetylglucosamine 2-epimerase
    • capsular polysaccharide synthesis enzyme CapG
    • capsular polysaccharide biosynthesis protein Cap5G
    • capsular polysaccharide synthesis enzyme Cap5G
    • capsular polysaccharide synthesis enzyme Cap8G
    • pseudogene
    • UDP-2-acetamido-2,6-dideoxy-beta-L-talose 2-epimerase
    • UDP-N-acetylglucosamine 2-epimerase CapG
    • uridine diphosphate-N-acetylglucosamine-2prime-epimerase
  • strand?: +
  • coordinates?: 1236748..1237872
  • synteny block?: BlockID0005150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0142 (cap5G)
    N315:
    SA0150 (capG)
    NCTC8325:
    Newman:
    NWMN_0101 (capG)
    USA300_FPR3757:
    SAUSA300_0158 (cap5G)
    04-02981:
    SA2981_0156 (capG)
    08BA02176:
    C248_0144 (capG)
    11819-97:
    MS7_0149
    71193:
    ST398NM01_0169
    ECT-R 2:
    ECTR2_112
    ED133:
    SAOV_0102
    ED98:
    SAAV_0123 (cap5G)
    HO 5096 0412:
    SAEMRSA15_01210 (capG)
    JH1:
    SaurJH1_0146
    JH9:
    SaurJH9_0141
    JKD6008:
    SAA6008_00133 (cap5G)
    JKD6159:
    SAA6159_00139 (cap5G)
    LGA251:
    SARLGA251_01290 (capG)
    M013:
    M013TW_0145
    MRSA252:
    SAR0157 (capG)
    MSHR1132:
    SAMSHR1132_01290
    MSSA476:
    SAS0130
    Mu3:
    SAHV_0154 (capG)
    Mu50:
    SAV0155 (capG)
    MW2:
    MW0130 (cap8G)
    RF122:
    SAB0096 (capG)
    ST398:
    SAPIG0169
    T0131:
    SAT0131_00145
    TCH60:
    HMPREF0772_10343 (capG)
    TW20:
    SATW20_01660 (capG)
    USA300_TCH1516:
    USA300HOU_0169 (cap5G)
    VC40:
    SAVC_00545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTLNQIFFDDLELRQPDH
    N315            MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTLNQIFFDDLELRQPDH
    NCTC8325        MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTLNQIFFDDLELRQPDH
    Newman          MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTLNQIFFDDLELRQPDH
    USA300_FPR3757  MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTLNQIFFDDLELRQPDH
                    ************************************************************

    COL             YLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAAVSAKRLKIPVFHMEAG
    N315            YLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAAVSAKRLKIPVFHMEAG
    NCTC8325        YLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAAVSAKRLKIPVFHMEAG
    Newman          YLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAAVSAKRLKIPVFHMEAG
    USA300_FPR3757  YLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAAVSAKRLKIPVFHMEAG
                    ************************************************************

    COL             NRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFNKANIFVTGSPMTEVIEAHR
    N315            NRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFNKANIFVTGSPMTEVIEAHR
    NCTC8325        NRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFNKANIFVTGSPMTEVIEAHR
    Newman          NRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFNKANIFVTGSPMTEVIEAHR
    USA300_FPR3757  NRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGLNKANIFVTGSPMTEVIEAHR
                    ***************************************:********************

    COL             DKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNAINDIAKKYKMPVIYSTHP
    N315            DKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNAINDIAKKYKMPVIYSTHP
    NCTC8325        DKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNAINDIAKKYKMPVIYSTHP
    Newman          DKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNAINDIAKKYKMPVIYSTHP
    USA300_FPR3757  DKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNAINDIAKKYKMPVIYSTHP
                    ************************************************************

    COL             RSWKKIEESKFEFDPLVKQLKPFGFFDYNALQKDAFVVLSDSGTLSEESSILKFPGVLIR
    N315            RSWKKIEESKFEFDPLVKQLKPFGFFDYNALQKDAFVVLSDSGTLSEESSILKFPGVLIR
    NCTC8325        RSWKKIEESKFEFDPLVKQLKPFGFFDYNALQKDAFVVLSDSGTLSEESSILKFPGVLIR
    Newman          RSWKKIEESKFEFDPLVKQLKPFGFFDYNALQKDAFVVLSDSGTLSEESSILKFPGVLIR
    USA300_FPR3757  RSWKKIEESKFEFDPLVKQLKPFGFFDYNALQKDAFVVLSDSGTLSEESSILKFPGVLIR
                    ************************************************************

    COL             TSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEPMIDAIDYKDTNVSTKVVKII
    N315            TSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEPMIDAIDYKDTNVSTKVVKII
    NCTC8325        TSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEPMIDAIDYKDTNVSTKVVKII
    Newman          TSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEPMIDAIDYKDTNVSTKVVKII
    USA300_FPR3757  TSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEPMIDAIDYKDTNVSTKVVKII
                    ************************************************************

    COL             QSYKDIINRNTWRK
    N315            QSYKDIINRNTWRK
    NCTC8325        QSYKDIINRNTWRK
    Newman          QSYKDIINRNTWRK
    USA300_FPR3757  QSYKDIINRNTWRK
                    **************