From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000991000
  • symbol?: capM
  • description?: sugar transferase

      descriptions from strain specific annotations:

    • sugar transferase
    • capsular polysaccharide biosynthesis galactosyltransferase Cap5M
    • capsular polysaccharide synthesis protein Cap5M
    • capsular polysaccharide biosynthesis protein Cap8M
    • capsular polysaccharide biosynthesis protein CapM
    • capsular polysaccharide biosynthesis protein Cap5M
    • capsular polysaccharide synthesis enzyme Cap5M
    • bacterial sugar transferase family protein
    • capsular polysaccharide biosynthesis galactosyltransferase CapM
    • capsular polysaccharide synthesis enzyme Cap8M
    • capsular polysaccharide synthesis enzyme CapM
    • glucosyltransferase EpsB domain protein
    • Undecaprenyl-phosphate beta-N-acetyl-D-fucosaminephosphotransferase
  • strand?: +
  • coordinates?: 1260411..1260968
  • synteny block?: BlockID0005240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0148 (cap5M)
    N315:
    SA0156 (capM)
    NCTC8325:
    Newman:
    NWMN_0107 (capM)
    USA300_FPR3757:
    SAUSA300_0164 (cap5M)
    04-02981:
    SA2981_0162 (capM)
    08BA02176:
    C248_0150 (capM)
    11819-97:
    MS7_0155
    71193:
    ST398NM01_0175
    ECT-R 2:
    ECTR2_118
    ED133:
    SAOV_0108
    ED98:
    SAAV_0129 (cap5M)
    HO 5096 0412:
    SAEMRSA15_01270 (capM)
    JH1:
    SaurJH1_0152
    JH9:
    SaurJH9_0147
    JKD6008:
    SAA6008_00139 (cap5M)
    JKD6159:
    SAA6159_00145 (cap5M)
    LGA251:
    SARLGA251_01350 (capM)
    M013:
    M013TW_0151
    MRSA252:
    SAR0163 (capM)
    MSHR1132:
    SAMSHR1132_01350
    MSSA476:
    SAS0136
    Mu3:
    SAHV_0160 (capM)
    Mu50:
    SAV0161 (capM)
    MW2:
    MW0136 (cap8M)
    RF122:
    SAB0102 (capM)
    ST398:
    SAPIG0175
    T0131:
    SAT0131_00152 (pbpC)
    TCH60:
    HMPREF0772_10337 (cap5M)
    TW20:
    SATW20_01720 (capM)
    USA300_TCH1516:
    USA300HOU_0175 (cap5M)
    VC40:
    SAVC_00575

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKI
    N315            MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKI
    NCTC8325        MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKI
    Newman          MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKI
    USA300_FPR3757  MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTINNELFNIYKFRSMKI
                    ************************************************************

    COL             DTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEK
    N315            DTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEK
    NCTC8325        DTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEK
    Newman          DTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEK
    USA300_FPR3757  DTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSIVGPRPALYNQYELIEK
                    ************************************************************

    COL             RTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTS
    N315            RTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTS
    NCTC8325        RTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTS
    Newman          RTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTS
    USA300_FPR3757  RTKANVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSMMLDMYIIYKTIKNIVTS
                    ************************************************************

    COL             EGVHH
    N315            EGVHH
    NCTC8325        EGVHH
    Newman          EGVHH
    USA300_FPR3757  EGVHH
                    *****