Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000993000
  • symbol?: capO
  • description?: capsular polysaccharide synthesis protein Cap8O

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap8O
    • capsular polysaccharide synthesis enzyme Cap8O
    • UDP-glucose/GDP-mannose dehydrogenase
    • capsular polysaccharide biosynthesis protein Cap5O
    • NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase
    • capsular polysaccharide synthesis enzyme CapO
    • capsular polysaccharide biosynthesis protein CapO
    • UDP-N-acetyl-D-mannosamine dehydrogenase
    • cap5O protein/UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase
    • UDP-N-acetyl-D-mannosamine 6-dehydrogenase
  • strand?: +
  • coordinates?: 1261910..1263172
  • synteny block?: BlockID0005260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0150 (cap5O)
    N315:
    SA0158 (capO)
    NCTC8325:
    Newman:
    NWMN_0109 (capO)
    USA300_FPR3757:
    SAUSA300_0166 (cap5O)
    04-02981:
    SA2981_0164 (capO)
    08BA02176:
    C248_0152 (capO)
    11819-97:
    MS7_0157 (wecC)
    71193:
    ST398NM01_0177
    ECT-R 2:
    ECTR2_120
    ED133:
    SAOV_0110
    ED98:
    SAAV_0131 (cap5O)
    HO 5096 0412:
    SAEMRSA15_01290 (capO)
    JH1:
    SaurJH1_0154
    JH9:
    SaurJH9_0149
    JKD6008:
    SAA6008_00141 (cap5O)
    JKD6159:
    SAA6159_00147 (cap5O)
    LGA251:
    SARLGA251_01370 (capO)
    M013:
    M013TW_0153
    MRSA252:
    SAR0165 (capO)
    MSHR1132:
    SAMSHR1132_01370
    MSSA476:
    SAS0138
    Mu3:
    SAHV_0162 (capO)
    Mu50:
    SAV0163 (capO)
    MW2:
    MW0138 (cap8O)
    RF122:
    SAB0104 (capO)
    ST398:
    SAPIG0177
    T0131:
    SAT0131_00154 (zur)
    TCH60:
    HMPREF0772_10335 (epsD)
    TW20:
    SATW20_01740 (capO)
    USA300_TCH1516:
    USA300HOU_0177 (cap5O)
    VC40:
    SAVC_00585

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQISIEEPGLQEVYEEVLS
    N315            MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQISIEEPGLQEVYEEVLS
    NCTC8325        MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQISIEEPGLQEVYEEVLS
    Newman          MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQISIEEPGLQEVYEEVLS
    USA300_FPR3757  MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQISIEEPGLQEVYEEVLS
                    ************************************************************

    COL             SGKLKVSTTPDASDVFIIAVPTPNNDDQYRSCDISLVMRALDSILSFLEKGNTIIVESTI
    N315            SGKLKVSTTPEASDVFIIAVPTPNNDDQYRSCDISLVMRALDSILPFLEKGNTIIVESTI
    NCTC8325        SGKLKVSTTPDASDVFIIAVPTPNNDDQYRSCDISLVMRALDSILSFLEKGNTIIVESTI
    Newman          SGKLKVSTTPDASDVFIIAVPTPNNDDQYRSCDISLVMRALDSILSFLEKGNTIIVESTI
    USA300_FPR3757  SGKLKVSTTPDASDVFIIAVPTPNNDDQYRSCDISLVMRALDSILSFLEKGNTIIVESTI
                    **********:**********************************.**************

    COL             APKTMDDFVKPVIENLGFTIGEDIYLVHCPERVLPGKILEELVHNNRIIGGVTEACIEAG
    N315            APKTMDDFVKPVIENLGFTIGEDICLVHCPERVLPGKILEELVHNNRIIGGVTKACIEAG
    NCTC8325        APKTMDDFVKPVIENLGFTIGEDIYLVHCPERVLPGKILEELVHNNRIIGGVTEACIEAG
    Newman          APKTMDDFVKPVIENLGFTIGEDIYLVHCPERVLPGKILEELVHNNRIIGGVTEACIEAG
    USA300_FPR3757  APKTMDDFVKPVIENLGFTIGEDIYLVHCPERVLPGKILEELVHNNRIIGGVTEACIEAG
                    ************************ ****************************:******

    COL             KRVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLDVIEMAN
    N315            KYVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLDVIEMAN
    NCTC8325        KRVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLDVIEMAN
    Newman          KRVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLDVIEMAN
    USA300_FPR3757  KRVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELTKICNNLNINVLDVIEMAN
                    * **********************************************************

    COL             KHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGREINNSMPAYVVDTTKQIIK
    N315            KHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGREINNSMPAYVVDTTKQIIK
    NCTC8325        KHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGREINNSMPAYVVDTTKQIIK
    Newman          KHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGREINNSMPAYVVDTTKQIIK
    USA300_FPR3757  KHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGREINNSMPAYVVDTTKQIIK
                    ************************************************************

    COL             VLSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIEVCAYDPHVELDFVEHDMSHA
    N315            ALSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIEVCAYDPHVELDFVEHDMSHA
    NCTC8325        VLSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIEVCAYDPHVELDFVEHDMSHA
    Newman          VLSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIEVCAYDPHVELDFVEHDMSHA
    USA300_FPR3757  VLSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIEVCAYDPHVELDFVEHDMSHA
                    .***********************************************************

    COL             VKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVVKSSFEDVSYYNYGNIFNFIDK
    N315            VKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVVKSSFEDVSYYNYGNIFNFIDK
    NCTC8325        VKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVVKSSFEDVSYYNYGNIFNFIDK
    Newman          VKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVVKSSFEDVSYYNYGNIFNFIDK
    USA300_FPR3757  VKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVVKSSFEDVSYYNYGNIFNFIDK
                    ************************************************************