From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000994000
  • symbol?: capP
  • description?: capsular polysaccharide synthesis protein Cap5P

      descriptions from strain specific annotations:

    • capsular polysaccharide synthesis protein Cap5P
    • capsular polysaccharide synthesis enzyme Cap5P
    • UDP-N-acetylglucosamine 2-epimerase
    • UDP-N-acetylglucosamine 2-epimerase Cap5P
    • Capsular polysaccharide synthesis enzyme Cap8P
    • UDP-N-acetylglucosamine 2-epimerase (UDP-GlcNAc-2-epimerase). domain protein
    • UDP-N-acetylglucosamine 2-epimerase CapP
    • capsular polysaccharide biosynthesis protein Cap5P
    • capsular polysaccharide biosynthesis protein CapP
    • capsular polysaccharide synthesis enzyme CapP
  • strand?: +
  • coordinates?: 1263219..1270246
  • synteny block?: BlockID0005270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0151 (cap5P)
    N315:
    SA0159 (capP)
    NCTC8325:
    Newman:
    NWMN_0110 (capP)
    USA300_FPR3757:
    SAUSA300_0167 (cap5P)
    04-02981:
    SA2981_0165
    08BA02176:
    C248_0153 (capP)
    11819-97:
    MS7_0158
    71193:
    ST398NM01_0178
    ECT-R 2:
    ECTR2_128
    ED133:
    SAOV_0111
    ED98:
    SAAV_0132 (cap5P)
    HO 5096 0412:
    SAEMRSA15_01300 (capP)
    JH1:
    SaurJH1_0155
    JH9:
    SaurJH9_0150
    JKD6008:
    SAA6008_00142 (cap5P)
    JKD6159:
    SAA6159_00148 (cap5P)
    LGA251:
    SARLGA251_01380 (capP)
    M013:
    M013TW_0154
    MRSA252:
    SAR0166 (capP)
    MSHR1132:
    SAMSHR1132_01380
    MSSA476:
    SAS0139
    Mu3:
    SAHV_0163 (capP)
    Mu50:
    SAV0164 (capP)
    MW2:
    MW0139 (cap8P)
    RF122:
    SAB0105 (capP)
    ST398:
    SAPIG0178
    T0131:
    SAT0131_00155 (mreB)
    TCH60:
    HMPREF0772_10334 (capP)
    TW20:
    SATW20_01750 (capP)
    USA300_TCH1516:
    USA300HOU_0178 (cap5P)
    VC40:
    SAVC_00590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MCLNFREDNVMKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLDSVLSI
    N315            MCLNFREDNVMKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLDSVLSI
    NCTC8325        ----------MKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLDSVLSI
    Newman          MCLNFREDNVMKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLDSVLSI
    USA300_FPR3757  MCLNFREDNVMKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIVITAQHRDMLDSVLSI
                              **************************************************

    COL             FDIQADHDLNIMQDQQTLAGLTANALAKLDSIINEEQPDMILVHGDTTTTFVGSLAAFYH
    N315            FDIQADHDLNIMQDQQTLADLTANALAKLDSIINEEQPDMILVHGDTTTTFVGSLAAFYH
    NCTC8325        FDIQADHDLNIMQDQQTLAGLTANALAKLDSIINEEQPDMILVHGDTTTTFVGSLAAFYH
    Newman          FDIQADHDLNIMQDQQTLAGLTANALAKLDSIINEEQPDMILVHGDTTTTFVGSLAAFYH
    USA300_FPR3757  FDIQADHDLNIMQDQQTLAGLTANALAKLDSIINEEQPDMILVHGDTTTTFVGSLAAFYH
                    *******************.****************************************

    COL             QIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKDKERIFIT
    N315            QIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKDKERIFIT
    NCTC8325        QIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKDKERIFIT
    Newman          QIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKDKERIFIT
    USA300_FPR3757  QIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIAAKNLLFENKDKERIFIT
                    ************************************************************

    COL             GNTVIDALSTTVQNDFVSTIINKHKGKKVVLLTAHRRENIGEPMHQIFKAVRDLADEYKD
    N315            GNTVIDALSTTVQNDFVSTIINKHKGKKVILLTAHRRENIGEPMHQIFKAVRDLADEYKD
    NCTC8325        GNTVIDALSTTVQNDFVSTIINKHKGKKVVLLTAHRRENIGEPMHQIFKAVRDLADEYKD
    Newman          GNTVIDALSTTVQNDFVSTIINKHKGKKVVLLTAHRRENIGEPMHQIFKAVRDLADEYKD
    USA300_FPR3757  GNTVIDALSTTVQNDFVSTIINKHKGKKVVLLTAHRRENIGEPMHQIFKAVRDLADEYKD
                    *****************************:******************************

    COL             VVFIYPMHRNPKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTDSGGIQEEAP
    N315            VVFIYPMHRNPKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTDSGGIQEEAP
    NCTC8325        VVFIYPMHRNLKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTDSGGIQEEAP
    Newman          VVFIYPMHRNPKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTDSGGIQEEAP
    USA300_FPR3757  VVFIYPMHRNPKVRAIAEKYLSGRNRIELIEPLDAIEFHNFTNQSYLVLTDSGGIQEEAP
                    ********** *************************************************

    COL             TFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQRMSQANNPYGD
    N315            TFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQRMSQANNPYGD
    NCTC8325        TFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQRMSQANNPYGD
    Newman          TFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQRMSQANNPYGD
    USA300_FPR3757  TFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQLIEDDEAYQRMSQANNPYGD
                    ************************************************************

    COL             GQASRRICEAIEYYFGLRTDKPDEFVPLRHK
    N315            GQASRRICEAIEYYFGLRSDKPDEFVPLRHK
    NCTC8325        GQASRRICEAIEYYFGLRTDKPDEFVPLRHK
    Newman          GQASRRICEAIEYYFGLRTDKPDEFVPLRHK
    USA300_FPR3757  GQASRRICEAIEYYFGLRTDKPDEFVPLRHK
                    ******************:************