Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001008000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 1275021..1275224
  • synteny block?: BlockID0005360
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0171
    08BA02176:
    C248_0159
    11819-97:
    MS7_0163
    71193:
    ST398NM01_0184
    ECT-R 2:
    ECTR2_133
    ED133:
    SAOV_0116
    ED98:
    HO 5096 0412:
    SAEMRSA15_01350
    JH1:
    SaurJH1_0160
    JH9:
    SaurJH9_0155
    JKD6008:
    SAA6008_00147
    JKD6159:
    SAA6159_00153
    LGA251:
    SARLGA251_01430
    M013:
    M013TW_0159
    MRSA252:
    SAR0171
    MSHR1132:
    SAMSHR1132_01430
    MSSA476:
    SAS0145
    Mu3:
    SAHV_0169
    Mu50:
    SAV0170
    MW2:
    MW0144
    RF122:
    SAB0110c
    ST398:
    SAPIG0184
    T0131:
    SAT0131_00160
    TCH60:
    HMPREF0772_10329
    TW20:
    SATW20_01800
    USA300_TCH1516:
    USA300HOU_0183
    VC40:
    SAVC_00615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDE
    N315            MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDE
    NCTC8325        MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDE
    USA300_FPR3757  MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDE
                    ************************************************************

    COL             NHLNDAT
    N315            NHLNDAT
    NCTC8325        NHLNDAT
    USA300_FPR3757  NHLNDAT
                    *******