From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001010000
  • symbol?: ssuB
  • description?: ABC transporter

      descriptions from strain specific annotations:

    • ABC transporter
    • putative ABC transporter, ATP-binding protein
    • nitrate transport ATP-binding protein nrtD
    • ABC transporter ATP-binding subunit
    • ABC transporter family protein
    • nitrite/nitrate ABC transporter ATP-binding protein
    • putative ABC transporter ATP-binding protein
    • ABC-type nitrate/sulfonate/bicarbonate transporter, TauB
    • taurine ABC superfamily ATP binding cassette transporter, ABC protein
    • taurine-transporting ATPase
    • nitrate/nitrite system ATP-binding ABC transporter
  • strand?: +
  • coordinates?: 1276244..1277011
  • synteny block?: BlockID0005380
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0173
    08BA02176:
    C248_0161
    11819-97:
    MS7_0165
    71193:
    ST398NM01_0186
    ECT-R 2:
    ECTR2_135
    ED133:
    SAOV_0118
    ED98:
    SAAV_0139
    HO 5096 0412:
    SAEMRSA15_01370
    JH1:
    SaurJH1_0162
    JH9:
    SaurJH9_0157
    JKD6008:
    SAA6008_00149 (tauB)
    JKD6159:
    SAA6159_00155 (tauB)
    LGA251:
    SARLGA251_01450
    M013:
    M013TW_0161
    MRSA252:
    SAR0173
    MSHR1132:
    SAMSHR1132_01450
    MSSA476:
    SAS0147
    Mu3:
    SAHV_0171
    Mu50:
    SAV0172
    MW2:
    MW0146
    RF122:
    SAB0112
    ST398:
    SAPIG0186
    T0131:
    SAT0131_00162
    TCH60:
    HMPREF0772_10327
    TW20:
    SATW20_01820
    USA300_TCH1516:
    USA300HOU_0185
    VC40:
    SAVC_00625

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLNVIGGFIHPSSGRVII
    NCTC8325        MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLNIIGGFIHPSSGRVII
    Newman          MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLNIIGGFIHPSSGRVII
    USA300_FPR3757  MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLNIIGGFIHPSSGRVII
                    *********************************************:**************

    N315            DNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGFQQKISDEEINAQLKLVDLEDRGKHF
    NCTC8325        DNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGLQQKISDEEINAQLKLVDLEDRGKHF
    Newman          DNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGLQQKISDEEINAQLKLVDLEDRGKHF
    USA300_FPR3757  DNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGLQQKISDEEINAQLKLVDLEDRGKHF
                    **********************************:*************************

    N315            PEQLSGGMKQRVALCRAHVHKPNVILMDEPLGALDAFTRYKLQDQLVQLKHKTQSTIILV
    NCTC8325        PEQLSGGMKQRVALCRAHVHKPNVILMDEPLGALDAFTRYKLQDQLVQLKHKTQSTIILV
    Newman          PEQLSGGMKQRVALCRAHVHKPNVILMDEPLGALDAFTRYKLQDQLVQLKHKTQSTIILV
    USA300_FPR3757  PEQLSGGMKQRVALCRAHVHKPNVISMDEPLGALDAFTRYKLQDQLVQLKHKTQSTIILV
                    ************************* **********************************

    N315            THDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHLLKIRNEIMETFALNHHQV
    NCTC8325        THDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHLLKIRNEIMETFALNHHQV
    Newman          THDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHLLKIRNEIMETFALNHHQV
    USA300_FPR3757  THDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHLLKIRNEIMETFALNHHQV
                    ************************************************************

    N315            EPEYYL
    NCTC8325        EPEYYL
    Newman          EPEYYL
    USA300_FPR3757  EPEYYL
                    ******