From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001013000
  • symbol?:
  • description?: Acyl-CoA dehydrogenase-like protein

      descriptions from strain specific annotations:

    • Acyl-CoA dehydrogenase-like protein
    • Acyl-CoA dehydrogenase, short-chain specific
    • pseudogene
    • short chain acyl-CoA dehydrogenase
    • Acyl-CoA dehydrogenase family protein
    • isovaleryl-CoA dehydrogenase
    • putative acyl-CoA dehydrogenase family protein
  • strand?: +
  • coordinates?: 1278776..1279814
  • synteny block?: BlockID0005410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0176
    08BA02176:
    C248_0164
    11819-97:
    MS7_0168
    71193:
    ST398NM01_0189
    ECT-R 2:
    ECTR2_138
    ED133:
    SAOV_0121
    ED98:
    SAAV_0142
    HO 5096 0412:
    SAEMRSA15_01400
    JH1:
    SaurJH1_0165
    JH9:
    SaurJH9_0160
    JKD6008:
    SAA6008_00152
    JKD6159:
    SAA6159_00158
    LGA251:
    SARLGA251_01480
    M013:
    M013TW_0164
    MRSA252:
    SAR0176
    MSHR1132:
    SAMSHR1132_01480
    MSSA476:
    SAS0150
    Mu3:
    SAHV_0174
    Mu50:
    SAV0175
    MW2:
    MW0149
    RF122:
    SAB0115
    ST398:
    SAPIG0189
    T0131:
    SAT0131_00165 (dnaG)
    TCH60:
    HMPREF0772_10324
    TW20:
    SATW20_01850
    USA300_TCH1516:
    USA300HOU_0188
    VC40:
    SAVC_00640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRKNAEVIEAVSQSCLTT
    N315            MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRKNAEVIEAVSQSCLTT
    NCTC8325        MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRKNAEVIEAVSQSCLTT
    Newman          MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRKNAEVIEAVSQSCLTT
    USA300_FPR3757  MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRKNAEVIEAVSQSCLTT
                    ************************************************************

    COL             GFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNPMKSFNDLEKLNLEHTY
    N315            GFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNPMKSFNDLEKLNLEHTY
    NCTC8325        GFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNPMKSFNDLEKLNLEHTY
    Newman          GFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNPMKSFNDLEKLNLEHTY
    USA300_FPR3757  GFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNPMKSFNDLEKLNLEHTY
                    ************************************************************

    COL             VDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRANQDGITLVEKTNFLGVNG
    N315            VDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRANQDGITLVEKTNFLGVNG
    NCTC8325        VDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRANQDGITLVEKTNFLGVNG
    Newman          VDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRANQDGITLVEKTNFLGVNG
    USA300_FPR3757  VDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRANQDGITLVEKTNFLGVNG
                    ************************************************************

    COL             SATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIGLGSIKSSLELIDAFSNVQ
    N315            SATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIGLGSIKSSLELIDAFSNAQ
    NCTC8325        SATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIGLGSIKSSLELIDAFSNVQ
    Newman          SATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIGLGSIKSSLELIDAFSNVQ
    USA300_FPR3757  SATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIGLGSIKSSLELIDAFSNVQ
                    **********************************************************.*

    COL             NGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLNELISLKKDIGYLLLDVNQASV
    N315            NGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLSELISLKKDIGYLLLDVNQASV
    NCTC8325        NGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLNELISLKKDIGYLLLDVNQASV
    Newman          NGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLNELISLKKDIGYLLLDVNQASV
    USA300_FPR3757  NGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLNELISLKKDIGYLLLDVNQASV
                    **************************************.*********************

    COL             VNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAELKG
    N315            VNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAELKG
    NCTC8325        VNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAELKG
    Newman          VNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAELKG
    USA300_FPR3757  VNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAELKG
                    *******************************************