From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001017000
  • symbol?:
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • drug transporter
    • integral membrane protein LmrP
    • drug transporter, putative
    • ImrP
    • integral membrane transport protein
    • major facilitator superfamily MFS_1
    • major facilitator superfamily multidrug cation symporter or antiporter
    • major facilitator superfamily protein
    • major facilitator transporter
    • MFS family major facilitator transporter, multidrug cation symporter or antiporter
    • pseudogene
    • putative transporter protein
    • transporter protein
  • strand?: +
  • coordinates?: 1282489..1283728
  • synteny block?: BlockID0005450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0179
    08BA02176:
    C248_0167
    11819-97:
    MS7_0171
    71193:
    ST398NM01_0192
    ECT-R 2:
    ECTR2_141
    ED133:
    SAOV_0122
    ED98:
    SAAV_0146
    HO 5096 0412:
    SAEMRSA15_01430
    JH1:
    SaurJH1_0168
    JH9:
    SaurJH9_0163
    JKD6008:
    SAA6008_00155
    JKD6159:
    SAA6159_00159
    LGA251:
    SARLGA251_01490
    M013:
    M013TW_0165
    MRSA252:
    SAR0179
    MSHR1132:
    SAMSHR1132_01510
    MSSA476:
    SAS0153
    Mu3:
    SAHV_0177
    Mu50:
    SAV0178
    MW2:
    MW0152
    RF122:
    SAB0118
    ST398:
    SAPIG0192
    T0131:
    SAT0131_00169 (glyS)
    TCH60:
    HMPREF0772_10321
    TW20:
    SATW20_01880
    USA300_TCH1516:
    USA300HOU_0191
    VC40:
    SAVC_00655

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIYLVGLVVLKFPLSIIS
    N315            MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIYLVGLVVLKFPLSIIS
    NCTC8325        MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIYLVGLVVLKFPLSIIS
    Newman          MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIYLVGLVVLKFPLSIIS
    USA300_FPR3757  MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIYLVGLVVLKFPLSIIS
                    ************************************************************

    COL             GYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVAYAIFTIVWGLQFPVMD
    N315            GYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVAYAIFTIVWGLQFPVMD
    NCTC8325        GYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVAYAIFTIVWGLQFPVMD
    Newman          GYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVAYAIFTIVWGLQFPVMD
    USA300_FPR3757  GYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVAYAIFTIVWGLQFPVMD
                    ************************************************************

    COL             TLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSMLLLFLIAACIFLIVLFIL
    N315            TLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSMLLLFLIAACIFLIVLFIL
    NCTC8325        TLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSMLLLFLIAACIFLIVLFIL
    Newman          TLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSMLLLFLIAACIFLIVLFIL
    USA300_FPR3757  TLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSMLLLFLIAACIFLIVLFIL
                    ************************************************************

    COL             YIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDRNYMLLISGFSIIMMGEFS
    N315            YIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDRNYMLLISGFSIIMMGEFS
    NCTC8325        YIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDRNYMLLISGFSIIMMGEFS
    Newman          YIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDRNYMLLISGFSIIMMGEFS
    USA300_FPR3757  YIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDRNYMLLISGFSIIMMGEFS
                    ************************************************************

    COL             ISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVILLTYSISKVVLKIDFKKAL
    N315            ISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVILLTYSISKVVLKIDFKKAL
    NCTC8325        ISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVILLTYSISKVVLKIDFKKAL
    Newman          ISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVILLTYSISKVVLKIDFKKAL
    USA300_FPR3757  ISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVILLTYSISKVVLKIDFKKAL
                    ************************************************************

    COL             ITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPIVSEQRFKIIPKAKRGTYSAV
    N315            ITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPIVSEQRFKIIPKAKRGTYSAV
    NCTC8325        ITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPIVSEQRFKIIPKAKRGTYSAV
    Newman          ITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPIVSEQRFKIIPKAKRGTYSAV
    USA300_FPR3757  ITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPIVSEQRFKIIPKAKRGTYSAV
                    ************************************************************

    COL             NALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGASMLVAGVFGGQKQVNTN
    N315            NALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGASMLVAGVFGGQKQVNTN
    NCTC8325        NALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGASMLVAGVFGGQKQVNTN
    Newman          NALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGASMLVAGVFGGQKQVNTN
    USA300_FPR3757  NALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGASMLVAGVFGGQKQVNTN
                    ********************************************************