From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001029000
  • symbol?:
  • description?: isochorismatase hydrolase

      descriptions from strain specific annotations:

    • isochorismatase hydrolase
    • Nicotinamidase/isochorismatase family protein
    • putative isochorismatase
    • Isochorismatase family protein
    • isochorismatase transposase
  • strand?: -
  • coordinates?: 1301733..1302230
  • synteny block?: BlockID0005560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0172 (entB)
    N315:
    NCTC8325:
    Newman:
    NWMN_0131 (entB)
    USA300_FPR3757:
    04-02981:
    SA2981_0188
    08BA02176:
    C248_0178
    11819-97:
    MS7_0180
    71193:
    ST398NM01_0204
    ECT-R 2:
    ECTR2_150
    ED133:
    SAOV_0131 (entB)
    ED98:
    SAAV_0155 (entB)
    HO 5096 0412:
    SAEMRSA15_01520
    JH1:
    SaurJH1_0177
    JH9:
    SaurJH9_0172
    JKD6008:
    SAA6008_00165
    JKD6159:
    SAA6159_00168
    LGA251:
    SARLGA251_01580
    M013:
    M013TW_0174
    MRSA252:
    SAR0188
    MSHR1132:
    SAMSHR1132_01620
    MSSA476:
    SAS0162
    Mu3:
    SAHV_0186
    Mu50:
    SAV0187
    MW2:
    MW0161
    RF122:
    SAB0127c
    ST398:
    SAPIG0204
    T0131:
    SAT0131_00179
    TCH60:
    HMPREF0772_10312 (entB)
    TW20:
    SATW20_01970
    USA300_TCH1516:
    USA300HOU_0200
    VC40:
    SAVC_00700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------MDYAPYTAENVVQNANKLIDVFRKNNGFIAFVRVNFYDGK
    N315            --------------------MDYAPHTAENVVQNANKLIDVFRKNNGFIAFVRVNFYDGK
    NCTC8325        --------------------MDYAPYTAENVVQNANKLIDVFRKNNGFIAFVRVNFYDGK
    Newman          MINFNKTALVLIDLQEGILKMDYAPYTAENVVQNANKLIDVFRKNNGFIAFVRVNFYDGK
    USA300_FPR3757  --------------------MDYAPYTAENVVQNANKLIDVFRKNNGFIAFVRVNFYDGK
                                        *****:**********************************

    COL             DVLQPNAMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFVGTDLDLQLRRRGIDTI
    N315            DVLQPNAMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFVGTDLDLQLRRRGIDTI
    NCTC8325        DVLQPNVMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFVGTDLDLQLRRRGIDTI
    Newman          DVLQPNAMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFVGTDLDLQLRRRGIDTI
    USA300_FPR3757  DVLQPNAMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFVGTDLDLQLRRRGIDTI
                    ******.*****************************************************

    COL             VLGGVATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFPIDNVFPLMGQTITTNDF
    N315            VLGGVATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFPIDNVFPLMGQTITTNDF
    NCTC8325        VLGGVATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFPIDNVFPLMGQTITTNDF
    Newman          VLGGVATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFPIDNVFPLMGQTITTNDF
    USA300_FPR3757  VLGGVATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFPIDNVFPLMGQTITTNDF
                    ************************************************************

    COL             LNILN
    N315            LNILN
    NCTC8325        LNILN
    Newman          LNILN
    USA300_FPR3757  LNILN
                    *****