From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001035000
  • symbol?:
  • description?: permease

      descriptions from strain specific annotations:

    • permease
    • PTS system, IIBC components
    • PTS system transporter
    • sucrose-specific PTS transporter IIBC component protein
    • sucrose-specific PTS transporter protein
    • N-acetylmuramic acid phosphotransfer permease
    • Permease IIC component
    • phosphotransferase system, EIIC
    • phosphotransferase system, EIIC family protein
    • PTS family sucrose porter component IIBC
    • PTS system, IIB component / PTS system, IIC component
    • pts system eiibc component
    • PTS system N-acetylmuramic acid-specific transporter subunit IIB
    • PTS system protein
    • PTS system sucrose-specific IIBC component
    • PTS system sucrose specific transporter protein
    • PTS system sucrose-specific transporter subunit IIBC
    • PTS system transporter subunit IIBC
    • PTS system transporter subunit IIC
  • strand?: +
  • coordinates?: 1309918..1311372
  • synteny block?: BlockID0005620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0193
    08BA02176:
    C248_0184
    11819-97:
    MS7_0185
    71193:
    ST398NM01_0210
    ECT-R 2:
    ECTR2_155
    ED133:
    SAOV_0137
    ED98:
    SAAV_0161
    HO 5096 0412:
    SAEMRSA15_01570
    JH1:
    SaurJH1_0182
    JH9:
    SaurJH9_0177
    JKD6008:
    SAA6008_00171 (murP)
    JKD6159:
    SAA6159_00174 (murP)
    LGA251:
    SARLGA251_01630
    M013:
    M013TW_0180
    MRSA252:
    SAR0193
    MSHR1132:
    SAMSHR1132_01670
    MSSA476:
    SAS0167
    Mu3:
    SAHV_0191
    Mu50:
    SAV0192
    MW2:
    MW0166
    RF122:
    SAB0132
    ST398:
    SAPIG0210
    T0131:
    SAT0131_00186
    TCH60:
    HMPREF0772_10306 (sacX)
    TW20:
    SATW20_02020
    USA300_TCH1516:
    USA300HOU_0206
    VC40:
    SAVC_00730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQELRHIDGVMGVIHDER
    N315            MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQELRHIDGVMGVIHDER
    NCTC8325        MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQELRHIDGVMGVIHDER
    Newman          MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQELRHIDGVMGVIHDER
    USA300_FPR3757  MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQELRHIDGVMGVIHDER
                    ************************************************************

    COL             IQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSYAADKAKANKEAHKAKQ
    N315            IQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSYAADKAKANKEAHKAKQ
    NCTC8325        IQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSYAADKAKANKEAHKAKQ
    Newman          IQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSYAADKAKANKEAHKAKQ
    USA300_FPR3757  IQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSYAADKAKANKEAHKAKQ
                    ************************************************************

    COL             KNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAGYISGAWITQLITVFNVI
    N315            KNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAGYISGAWITQLITVFNVI
    NCTC8325        KNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAGYISGAWITQLITVFNVI
    Newman          KNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAGYISGAWITQLITVFNVI
    USA300_FPR3757  KNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAGYISGAWITQLITVFNVI
                    ************************************************************

    COL             KDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGKNILMNVFTGEPLQPGQGG
    N315            KDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGKNILMNVFTGEPLQPGQGG
    NCTC8325        KDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGKNILMNVFTGEPLQPGQGG
    Newman          KDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGKNILMNVFTGEPLQPGQGG
    USA300_FPR3757  KDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGKNILMNVFTGEPLQPGQGG
                    ************************************************************

    COL             IIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGLLTIFIFMPLAGFVSDSLVS
    N315            IIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGLLTIFIFMPLAGFVSDSLVS
    NCTC8325        IIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGLLTIFIFMPLAGFVSDSLVS
    Newman          IIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGLLTIFIFMPLAGFVSDSLVS
    USA300_FPR3757  IIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGLLTIFIFMPLAGFVSDSLVS
                    ************************************************************

    COL             VVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEMINQSGATYLLPIAAMAGAGQ
    N315            VVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEMINQSGATYLLPIAAMAGAGQ
    NCTC8325        VVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEMINQSGATYLLPIAAMAGAGQ
    Newman          VVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEMINQSGATYLLPIAAMAGAGQ
    USA300_FPR3757  VVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEMINQSGATYLLPIAAMAGAGQ
                    ************************************************************

    COL             VGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYGVTLPLGRPFLTACIGGGIGGA
    N315            VGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYGVTLPLGRPFLTACIGGGIGGA
    NCTC8325        VGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYGVTLPLGRPFLTACIGGGIGGA
    Newman          VGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYGVTLPLGRPFLTACIGGGIGGA
    USA300_FPR3757  VGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYGVTLPLGRPFLTACIGGGIGGA
                    ************************************************************

    COL             VIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLAAYAGGFVCTYLFGTTKAMRQTD
    N315            VIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLAAYAGGFVCTYLFGTTKAMRQTD
    NCTC8325        VIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLAAYAGGFVCTYLFGTTKAMRQTD
    Newman          VIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLAAYAGGFVCTYLFGTTKAMRQTD
    USA300_FPR3757  VIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLAAYAGGFVCTYLFGTTKAMRQTD
                    ************************************************************

    COL             LLGD
    N315            LLGD
    NCTC8325        LLGD
    Newman          LLGD
    USA300_FPR3757  LLGD
                    ****