From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001037000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 1312678..1313862
  • synteny block?: BlockID0005640
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0195
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    SaurJH1_0184
    JH9:
    SaurJH9_0179
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0195
    MSHR1132:
    SAMSHR1132_01690
    MSSA476:
    SAS0169
    Mu3:
    SAHV_0193
    Mu50:
    SAV0194
    MW2:
    MW0168
    RF122:
    SAB0134c
    ST398:
    T0131:
    TCH60:
    HMPREF0772_10304
    TW20:
    SATW20_02040
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MVLITYQIILFFIISLSYYLTLNHYMAVTVGNFTSIFGMFAAILFMYYYLLYKSPEYNQR
    NCTC8325        MVLITYQIILFFIISLSYYLTLNHYMAVTVGNFTSIFGMFAAILFMYYYLLYKSPEYNQR
    Newman          MVLITYQIILFFIISLSYYLTLNHYMAVTVGNFTSIFGMFAAILFMYYYLLYKSPEYNQR
                    ************************************************************

    N315            KRFKHFIHITNLIIIAFSTFVLVHLALKLFFSI
    NCTC8325        KRFKHFIHITNLIIIAFSTFVLVHLALKLFFSI
    Newman          KRFKHFIHITNLIIIAFSTFVLVHLALKLFFSI
                    *********************************