From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001040000
  • symbol?: hsdR
  • description?: type I restriction enzyme restriction protein

      descriptions from strain specific annotations:

    • type I restriction enzyme restriction protein
    • type I restriction enzyme restriction chain
    • HsdR family type I site-specific deoxyribonuclease
    • Type I restriction-modification system, restriction subunit R
    • type I site-specific deoxyribonuclease, HsdR family protein
    • type I restriction-modification enzyme, R subunit
    • type-1 restriction enzyme R protein
    • type-I restriction-modification system restriction endonuclease subunit
    • type I site-specific deoxyribonuclease restriction subunit
    • type I site-specific deoxyribonuclease, HsdR family subfamily, putative
    • Type I restriction-modification system restriction subunit
    • putative type I restriction enzyme
    • type I restriction-modification system subunit R
  • strand?: +
  • coordinates?: 1314086..1316875
  • synteny block?: BlockID0005670
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0189 (hsdR)
    NCTC8325:
    Newman:
    NWMN_0139 (hsdR)
    USA300_FPR3757:
    04-02981:
    SA2981_0196 (hsdR)
    08BA02176:
    C248_0187
    11819-97:
    MS7_0187 (hsdR)
    71193:
    ST398NM01_0213
    ECT-R 2:
    ECTR2_157 (hsdR)
    ED133:
    SAOV_0140
    ED98:
    SAAV_0163
    HO 5096 0412:
    SAEMRSA15_01600
    JH1:
    SaurJH1_0185
    JH9:
    SaurJH9_0180
    JKD6008:
    SAA6008_00173 (hsdR)
    JKD6159:
    SAA6159_00176
    LGA251:
    SARLGA251_01660
    M013:
    M013TW_0183
    MRSA252:
    SAR0196
    MSHR1132:
    SAMSHR1132_01700
    MSSA476:
    SAS0170
    Mu3:
    SAHV_0194 (hsdR)
    Mu50:
    SAV0195 (hsdR)
    MW2:
    MW0169 (hsdR)
    RF122:
    SAB0135
    ST398:
    SAPIG0213
    T0131:
    SAT0131_00189
    TCH60:
    HMPREF0772_10303 (hsdR)
    TW20:
    SATW20_02050
    USA300_TCH1516:
    USA300HOU_0208 (hsdR2)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERHADKLEGNPLTDKEFQ
    N315            MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERHADKLEGNPLTDKEFQ
    NCTC8325        MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERHADKLEGNPLTDKEFQ
    Newman          MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERHADKLEGNPLTDKEFQ
    USA300_FPR3757  MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERHADKLEGNPLTDKEFQ
                    ************************************************************

    COL             RLLTMIDGKSIFESARILRDKLPLRRDDESEIYLSFLDTKSWCKNKFQVTNQVSVEDTYK
    N315            RLLTMIDGKSIFESARILRDKLPLRRDDESEIYLSFLDKKSWCKNKFQVTNQVSVEDTYK
    NCTC8325        RLLTMIDGKSIFESARILRDKLPLRRDDESEIYLSFLDTKSWCKNKFQVTNQVSVEDTYK
    Newman          RLLTMIDGKSIFESARILRDKLPLRRDDESEIYLSFLDTKSWCKNKFQVTNQVSVEDTYK
    USA300_FPR3757  RLLTMIDGKSIFESARILRDKLPLRRDDESEIYLSFLDTKSWCKNKFQVTNQVSVEDTYK
                    **************************************.*********************

    COL             ARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTGLFRYIQMFIISNGVETR
    N315            ARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTGLFRYIQMFIISNGVETR
    NCTC8325        ARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTGLFRYIQMFIISNGVETR
    Newman          ARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTGLFRYIQMFIISNGVETR
    USA300_FPR3757  ARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTGLFRYIQMFIISNGVETR
                    ************************************************************

    COL             YFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLAKMISRYMIINETDRILMA
    N315            YFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLAKMISRYMIINETDRILMA
    NCTC8325        YFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLAKMISRYMIINETDRILMA
    Newman          YFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLAKMISRYMIINETDRILMA
    USA300_FPR3757  YFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLAKMISRYMIINETDRILMA
                    ************************************************************

    COL             MRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKASQILSQQDDIKKVIFLVDRK
    N315            MRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKASQILSQQDDIKKVIFLVDRK
    NCTC8325        MRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKASQILSQQDDIKKVIFLVDRK
    Newman          MRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKASQILSQQDDIKKVIFLVDRK
    USA300_FPR3757  MRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKASQILSQQDDIKKVIFLVDRK
                    ************************************************************

    COL             DLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIVTTIQKMAKAIQGNAPLLEQY
    N315            DLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIVTTIQKMAKAIQGNAHLLEQY
    NCTC8325        DLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIVTTIQKMAKAIQGNAPLLEQY
    Newman          DLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIVTTIQKMAKAIQGNAPLLEQY
    USA300_FPR3757  DLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIVTTIQKMAKAIQGNAPLLEQY
                    ****************************************************** *****

    COL             KTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGTPRFPENSSQDGRTTADIFGRC
    N315            KTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGTPRFPENSSQDGRTTADIFGRC
    NCTC8325        KTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGTPRFPENSSQDGRTTADIFGRC
    Newman          KTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGTPRFPENSSQDGRTTADIFGRC
    USA300_FPR3757  KTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGTPRFPENSSQDGRTTADIFGRC
                    ************************************************************

    COL             LHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSMVEAIDTEEVWLADKRVELVTRH
    N315            LHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSMVEAIDTEEVWLADKRVELVTRH
    NCTC8325        LHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSMVEAIDTEEVWLADKRVELVTRH
    Newman          LHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSMVEAIDTEEVWLADKRVELVTRH
    USA300_FPR3757  LHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSMVEAIDTEEVWLADKRVELVTRH
                    ************************************************************

    COL             IINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLNKKLEQPLTIAGIFTFKPNEDDRD
    N315            IINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLNKKLEQPLTIAGIFTFKPNEDDRD
    NCTC8325        IINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLNKKLEQPLTIAGIFTFKPNEDDRD
    Newman          IINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLNKKLEQPLTIAGIFTFKPNEDDRD
    USA300_FPR3757  IINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLNKKLEQPLTIAGIFTFKPNEDDRD
                    ************************************************************

    COL             GEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFNHISKNVKKGVKDSKIDILIVVNMF
    N315            GEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFNHISKNVKKGVKDSKIDILIVVNMF
    NCTC8325        GEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFNHISKNVKKGVKDSKIDILIVVNMF
    Newman          GEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFNHISKNVKKGVKDSKIDILIVVNMF
    USA300_FPR3757  GEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFNHISKNVKKGVKDSKIDILIVVNMF
                    ************************************************************

    COL             LTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEKESKPFGKIVNYRDLKKETDDALRVF
    N315            LTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEKESKPFGKIVNYRDLKKETDDALRVF
    NCTC8325        LTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEKESKPFGKIVNYRDLKKETDDALRVF
    Newman          LTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEKESKPFGKIVNYRDLKKETDDALRVF
    USA300_FPR3757  LTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEKESKPFGKIVNYRDLKKETDDALRVF
                    ************************************************************

    COL             SQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPTPHMVDDIQDEEELKRFVEAYRLLAKI
    N315            SQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPTPHMVDDIQDEEELKRFVEAYRLLAKI
    NCTC8325        SQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPTPHMVDDIQDEEELKRFVEAYRLLAKI
    Newman          SQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPTPHMVDDIQDEEELKRFVEAYRLLAKI
    USA300_FPR3757  SQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPTPHMVDDIQDEEELKRFVEAYRLLAKI
                    ************************************************************

    COL             ILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLAVYDQVKRATAEKNKVSILNDIDFEIEM
    N315            ILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLAVYDQVKRATAEKNKVSILNDIDFEIEM
    NCTC8325        ILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLAVYDQVKRATAEKNKVSILNDIDFEIEM
    Newman          ILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLAVYDQVKRATAEKNKVSILNDIDFEIEM
    USA300_FPR3757  ILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLAVYDQVKRATAEKNKVSILNDIDFEIEM
                    ************************************************************

    COL             MRNDTINVNYIMNILRQIDLEDKAEQRRNQEQIRRILDHADDPTLRLKRDLIREFIDNVV
    N315            MRNDTINVNYIMNILRQIDLEDKAEQRRNQEQIRRILDHADDPTLRLKRDLIREFIDNVV
    NCTC8325        MRNDTINVNYIMNILRQIDLEDKAEQRRNQEQIRRILDHADDPTLRLKRDLIREFIDNVV
    Newman          MRNDTINVNYIMNILRQIDLEDKAEQRRNQEQIRRILDHADDPTLRLKRDLIREFIDNVV
    USA300_FPR3757  MRNDTINVNYIMNILRQIDLEDKAEQRRNQEQIRRILDHADDPTLRLKRDLIREFIDNVV
                    ************************************************************

    COL             PSLNKDDDIDQEYVNFESIKKEAEFKGFAGERSIDEQALKTISNDYQYSGVVNPHHLKKM
    N315            PSLNKDDDIDQEYVNFESIKKEAEFKGFAGERSIDEQALKTISNDYQYSGVVNPHHLKKM
    NCTC8325        PSLNKDDDIDQEYVNFESIKKEAEFKGFAGERSIDEQALKTISNDYQYSGVVNPHHLKKM
    Newman          PSLNKDDDIDQEYVNFESIKKEAEFKGFAGERSIDEQALKTISNDYQYSGVVNPHHLKKM
    USA300_FPR3757  PSLNKDDDIDQEYVNFESIKKEAEFKGFAGERSIDEQALKTISNDYQYSGVVNPHHLKKM
                    ************************************************************

    COL             IGDLPLKEKRKARKAIESFVAETTEKYGV
    N315            IGDLPLKEKRKARKAIESFVAETTEKYGV
    NCTC8325        IGDLPLKEKRKARKAIESFVAETTEKYGV
    Newman          IGDLPLKEKRKARKAIESFVAETTEKYGV
    USA300_FPR3757  IGDLPLKEKRKARKAIESFVAETTEKYGV
                    *****************************