From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001058000
  • symbol?:
  • description?: Oligopeptide transport system permease protein

      descriptions from strain specific annotations:

    • Oligopeptide transport system permease protein
    • oligopeptide ABC transporter
    • putative dipeptide transport system permease protein DppC
    • peptide ABC transporter permease
    • putative transport system permease
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • binding-protein-dependent transport system inner membrane protein
    • Putative glutathione transporter, permease component
    • Dipeptide transport system permease protein DppC
    • binding-protein-dependent transport system inner membrane component family protein
    • binding--dependent transport system inner membrane component family protein
    • oligopeptide ABC transporter membrane protein
  • strand?: +
  • coordinates?: 1333007..1334179
  • synteny block?: BlockID0005800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0208
    08BA02176:
    C248_0191
    11819-97:
    MS7_0193
    71193:
    ST398NM01_0217
    ECT-R 2:
    ECTR2_168
    ED133:
    SAOV_0146
    ED98:
    SAAV_0173
    HO 5096 0412:
    SAEMRSA15_01660
    JH1:
    SaurJH1_0198
    JH9:
    SaurJH9_0192
    JKD6008:
    SAA6008_00177
    JKD6159:
    SAA6159_00182
    LGA251:
    SARLGA251_01720
    M013:
    M013TW_0187
    MRSA252:
    SAR0200
    MSHR1132:
    SAMSHR1132_01730
    MSSA476:
    SAS0183
    Mu3:
    SAHV_0206
    Mu50:
    SAV0207
    MW2:
    MW0183
    RF122:
    SAB0146
    ST398:
    SAPIG0217
    T0131:
    SAT0131_00193
    TCH60:
    HMPREF0772_10299
    TW20:
    SATW20_02090
    USA300_TCH1516:
    USA300HOU_0214
    VC40:
    SAVC_00775

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQLNSKIASLKLFASYAIATYILVILTSALNLFKGYVADTFYIAETLLIVLTIILIIIL
    N315            MVKLTTKIASLKLFASYAIATYILVMLTSALNLFKGYVADTFYIAETLLIILTIILIIIL
    NCTC8325        MAQLNSKIASLKLFASYAIATYILVILTSALNLFKGYVADTFYIAETLLIVLTIILIIIL
    Newman          MAQLNSKIASLKLFASYAIATYILVILTSALNLFKGYVADTFYIAETLLIVLTIILIIIL
    USA300_FPR3757  MAQLNSKIASLKLFASYAIATYILVILTSALNLFKGYVADTFYIAETLLIVLTIILIIIL
                    *.:*.:*******************:************************:*********

    COL             TTEQTWKHHDLWRRIVEVLLLLMTLTGNVFTLLMFVSIRRYQRTSQIHSYNGWESFIRKT
    N315            TTEQTWKHHDLWRRIVEVLLLLMALTGNVFTLLMFVSIRRYQRTSQIHSYNGWESFIRKT
    NCTC8325        TTEQTWKHHDLWRRIVEVLLLLMTLTGNVFTLLMFVSIRRYQRTSQIHSYNGWESFIRKT
    Newman          TTEQTWKHHDLWRRIVEVLLLLMTLTGNVFTLLMFVSIRRYQRTSQIHSYNGWESFIRKT
    USA300_FPR3757  TTEQTWKHHDLWRRIVEVLLLLMTLTGNVFTLLMFVSIRRYQRTSQIHSYNGWESFIRKT
                    ***********************:************************************

    COL             TRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHGPSLAYPFGTDDFGRDLF
    N315            TRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHGPSLAYPFGTDDFGRDLF
    NCTC8325        TRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHGPSLAYPFGTDDFGRDLF
    Newman          TRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHGPSLAYPFGTDDFGRDLF
    USA300_FPR3757  TRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHGPSLAYPFGTDDFGRDLF
                    ************************************************************

    COL             TRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLIMRILDVVFAIPSLLLAVA
    N315            TRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLIMRILDVVFAIPSLLLAVA
    NCTC8325        TRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLIMRILDVVFAIPSLLLAVA
    Newman          TRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLIMRILDVVFAIPSLLLAVA
    USA300_FPR3757  TRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLIMRILDVVFAIPSLLLAVA
                    ************************************************************

    COL             IIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYVDAARITGENTWNIIWRYIL
    N315            IIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYVDAARITGENTWNIIWRYIL
    NCTC8325        IIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYVDAARITGENTWNIIWRYIL
    Newman          IIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYVDAARITGENTWNIIWRYIL
    USA300_FPR3757  IIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYVDAARITGENTWNIIWRYIL
                    ************************************************************

    COL             PNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWGNILRTGSNYLETHSNLAIVP
    N315            PNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWGNILRTGSNYLETHSNLAIVP
    NCTC8325        PNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWGNILRTGSNYLETHSNLAIVP
    Newman          PNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWGNILRTGSNYLETHSNLAIVP
    USA300_FPR3757  PNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWGNILRTGSNYLETHSNLAIVP
                    ************************************************************

    COL             GVCIMFVVLAFNFIGDAVRDALDPRIH
    N315            GVCIMFVVLAFNFIGDAVRDALDPRIH
    NCTC8325        GVCIMFVVLAFNFIGDAVRDALDPRIH
    Newman          GVCIMFVVLAFNFIGDAVRDALDPRIH
    USA300_FPR3757  GVCIMFVVLAFNFIGDAVRDALDPRIH
                    ***************************