From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001059000
  • symbol?:
  • description?: RGD-containing lipoprotein

      descriptions from strain specific annotations:

    • RGD-containing lipoprotein
    • RGD domain-containing lipoprotein
    • bacterial extracellular solute-binding s, 5 Middle family protein
    • ABC-type dipeptide transport system periplasmic component-like protein
    • Oligopeptide-binding protein
  • strand?: +
  • coordinates?: 1334196..1335971
  • synteny block?: BlockID0005810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0201 (rlp)
    NCTC8325:
    Newman:
    NWMN_0146 (rlp)
    USA300_FPR3757:
    04-02981:
    SA2981_0209 (rlp)
    08BA02176:
    C248_0192 (rlp)
    11819-97:
    MS7_0194
    71193:
    ST398NM01_0218
    ECT-R 2:
    ECTR2_169
    ED133:
    SAOV_0147
    ED98:
    SAAV_0174
    HO 5096 0412:
    SAEMRSA15_01670 (rlp)
    JH1:
    SaurJH1_0199
    JH9:
    SaurJH9_0193
    JKD6008:
    SAA6008_00178 (rlp)
    JKD6159:
    SAA6159_00183 (rlp)
    LGA251:
    SARLGA251_01730 (rlp)
    M013:
    M013TW_0188
    MRSA252:
    SAR0201 (rlp)
    MSHR1132:
    SAMSHR1132_01740
    MSSA476:
    SAS0184
    Mu3:
    SAHV_0207 (rlp)
    Mu50:
    SAV0208 (rlp)
    MW2:
    MW0184 (rlp)
    RF122:
    SAB0147
    ST398:
    SAPIG0218
    T0131:
    SAT0131_00194
    TCH60:
    HMPREF0772_10298 (rlp)
    TW20:
    SATW20_02100 (rlp)
    USA300_TCH1516:
    USA300HOU_0215 (rlp)
    VC40:
    SAVC_00780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHFLGQASYENDMNIVKD
    N315            MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHFLGQASYENDMNIVKD
    NCTC8325        MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHFLGQASYENDMNIVKD
    Newman          MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHFLGQASYENDMNIVKD
    USA300_FPR3757  MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHFLGQASYENDMNIVKD
                    ************************************************************

    COL             QLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPNYAMTALFSSTGSNSLL
    N315            QLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPNYAMTALFSSTGSNSLL
    NCTC8325        QLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPNYAMTALFSSTGSNSLL
    Newman          QLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPNYAMTALFSSTGSNSLL
    USA300_FPR3757  QLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPNYAMTALFSSTGSNSLL
                    ************************************************************

    COL             KDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYGSKKNLVYDNKVLDKNSV
    N315            KDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYGSKKNLVYDNKVLDKNSV
    NCTC8325        KDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYGSKKNLVYDNKVLDKNSV
    Newman          KDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYGSKKNLVYDNKVLDKNSV
    USA300_FPR3757  KDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYGSKKNLVYDNKVLDKNSV
                    ************************************************************

    COL             GLPNSRALIWQQFDYNNSRERDTRPLVMTQQDGEIPTLDPIRSIAPSVYSINMNMYTRLL
    N315            GLPNSRALIWQQFDYNNSRERDTRPLVMTQQDGEIPTLDPIRSIAPSVYSINMNMYTRLL
    NCTC8325        GLPNSRALIWQQFDYNNSRERDTRPLVMTQQDGEIPTLDPIRSIAPSVYSINMNMYTRLL
    Newman          GLPNSRALIWQQFDYNNSRERDTRPLVMTQQDGEIPTLDPIRSIAPSVYSINMNMYTRLL
    USA300_FPR3757  GLPNSRALIWQQFDYNNSRERDTRPLVMTQQDGEIPTLDPIRSIAPSVYSINMNMYTRLL
                    ************************************************************

    COL             LLDENDHLTTKGSLSHDYAVNKDNKAFYFLLRDDDYFAKVVNGQARNTGERVSAEDVKFS
    N315            LLDENDHLTTKGSLSRDYAVNKDNKAFYFLLRDDDYFAKVVNGQARNTGERVSAEDVKFS
    NCTC8325        LLDENDHLTTKGSLSHDYAVNKDNKAFYFLLRDDDYFAKVVNGQARNTGERVSAEDVKFS
    Newman          LLDENDHLTTKGSLSHDYAVNKDNKAFYFLLRDDDYFAKVVNGQARNTGERVSAEDVKFS
    USA300_FPR3757  LLDENDHLTTKGSLSHDYAVNKDNKAFYFLLRDDDYFAKVVNGQARNTGERVSAEDVKFS
                    ***************:********************************************

    COL             LDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEKDKDDKSIYDKLIKAYNVKSL
    N315            LDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEKDKDDKSIYDKLIKAYNVKSL
    NCTC8325        LDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEKDKDDKSIYDKLIKAYNVKSL
    Newman          LDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEKDKDDKSIYDKLIKAYNVKSL
    USA300_FPR3757  LDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEKDKDDKSIYDKLIKAYNVNSL
                    *********************************************************:**

    COL             TTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGILSKKFVNQVNQEYPKGYGDSS
    N315            TTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGILSKKFVNQVNQEYPKGYGDSS
    NCTC8325        TTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGILSKKFVNQVNQEYPKGYGDSS
    Newman          TTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGILSKKFVNQVNQEYPKGYGDSS
    USA300_FPR3757  TTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGILSKKFVNQVNQEYPKGYGDSS
                    ************************************************************

    COL             TIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNETEKGSYGPAKIKNITLKFNGDP
    N315            TIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNETEKGSYGSPKIKNITLKFNGDP
    NCTC8325        TIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNETEKGSYGPAKIKNITLKFNGDP
    Newman          TIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNETEKGSYGPAKIKNITLKFNGDP
    USA300_FPR3757  TIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNETEKGSYGPAKIKNITLKFNGDP
                    *********************************************..*************

    COL             NNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRKNGRKSVFLMLNIKKGIFKTHPNL
    N315            NNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRKNGRKSVFLMLNIKKGIFKTHPNL
    NCTC8325        NNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRKNGRKSVFLMLNIKKGIFKTHPNL
    Newman          NNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRKNGRKSVFLMLNIKKGIFKTHPNL
    USA300_FPR3757  NNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRKNGRKSVFLMLNIKKGIFKTHPNL
                    ************************************************************

    COL             RQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGNEQRQDLEKVEKAINQ
    N315            RQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGNEQRQDLEKVEKAINQ
    NCTC8325        RQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGNEQRQDLEKVEKAINQ
    Newman          RQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGNEQRQDLEKVEKAINQ
    USA300_FPR3757  RQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGNEQRQDLEKVEKAINQ
                    ***************************************************