From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001061000
  • symbol?:
  • description?: lipoprotein

      descriptions from strain specific annotations:

    • lipoprotein
    • staphylococcus tandem lipoproteins family protein
    • Membrane lipoprotein
    • putative staphylococcal lipoprotein
    • putative lipoprotein
  • strand?: -
  • coordinates?: 1338346..1339119
  • synteny block?: BlockID0005830
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0211
    08BA02176:
    C248_0194
    11819-97:
    MS7_0196
    71193:
    ST398NM01_0220
    ECT-R 2:
    ECTR2_171
    ED133:
    ED98:
    SAAV_0176
    HO 5096 0412:
    SAEMRSA15_01690
    JH1:
    SaurJH1_0201
    JH9:
    SaurJH9_0195
    JKD6008:
    JKD6159:
    SAA6159_00185
    LGA251:
    M013:
    M013TW_0190
    MRSA252:
    MSHR1132:
    SAMSHR1132_01760
    MSSA476:
    SAS0186
    Mu3:
    SAHV_0209
    Mu50:
    SAV0210
    MW2:
    MW0186
    RF122:
    ST398:
    SAPIG0220
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0217
    VC40:
    SAVC_00790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKAHKIFWLNLAAIIIISIVVSGDMFLAMKWEQIHLKDGLKKVLSTYPIKNLETLYEIDG
    N315            MKAHKIFWLNLAAIIIISIVVSGGMFLAMKWEQIHLKDGLKKVLSTYPIKNLETLYEIDG
    NCTC8325        MKAHKIFWLNLAAIIIISIVVSGDMFLAMKWEQIHLKDGLKKVLSTYPIKNLETLYEIDG
    Newman          MKAHKIFWLNLAAIIIISIVVSGDMFLAMKWEQIHLKDGLKKVLSTYPIKNLETLYEIDG
    USA300_FPR3757  MKAHKIFWLNLAAIIIISIVVSGDMFLAMKWEQIHLKDGLKKVLSTYPIKNLETLYEIDG
                    ***********************.************************************

    COL             HDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTTNDKKNAT
    N315            HDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTTNDRKDAT
    NCTC8325        HDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTTNDRKNAT
    Newman          HDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTTNDKKNAT
    USA300_FPR3757  HDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHKITGEYDTTTNDKKNAT
                    *******************************************************:*:**

    COL             DSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTT
    N315            DSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTT
    NCTC8325        DSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTT
    Newman          DSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTT
    USA300_FPR3757  DSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDLTSILNSNDLKVTHDPTT
                    ************************************************************

    COL             DYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGK
    N315            DYYNLSGKLSNDNPNVKQLKRRYNIPSNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGK
    NCTC8325        DYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGK
    Newman          DYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGK
    USA300_FPR3757  DYYNLSGKLSNDNPNVKQLKRRYNIPKNASTKVELKGMSDLKGNNHQDQKLYFYFSSPGK
                    **************************.*********************************

    COL             DQIIYKESLTYNKISEH
    N315            NQIIYKESLTYNKLSEH
    NCTC8325        DQIIYKESLTYNKISEH
    Newman          DQIIYKESLTYNKISEH
    USA300_FPR3757  DQIIYKESLTYNKISEH
                    :************:***