Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001062000
  • symbol?: azoR
  • description?: azoreductase

      descriptions from strain specific annotations:

    • azoreductase
    • FMN-dependent NADH-azoreductase
    • flavodoxin-like fold family protein
    • putative phosphodiesterase
    • FMN-dependent NADH-azoreductase, AzoR
    • fmn-dependent NADH-azoreductase (fmn-dependent nadh-azocompound oxidoreductase) (azo-dye reductase)
    • NAD(P)H dehydrogenase (quinone), putative
    • FMN-dependent NADH-azoreductase 2
  • strand?: -
  • coordinates?: 1339320..1339946
  • synteny block?: BlockID0005840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0190 (acpD)
    N315:
    SA0204 (acpD)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0212
    08BA02176:
    C248_0195
    11819-97:
    MS7_0197 (azoR2)
    71193:
    ST398NM01_0221
    ECT-R 2:
    ECTR2_172
    ED133:
    SAOV_0149
    ED98:
    SAAV_0177 (acpD)
    HO 5096 0412:
    SAEMRSA15_01700
    JH1:
    SaurJH1_0202
    JH9:
    SaurJH9_0196
    JKD6008:
    SAA6008_00180 (azoR)
    JKD6159:
    SAA6159_00186 (azoR)
    LGA251:
    SARLGA251_01750
    M013:
    M013TW_0191
    MRSA252:
    SAR0203 (acpD)
    MSHR1132:
    SAMSHR1132_01770
    MSSA476:
    SAS0187 (acpD)
    Mu3:
    SAHV_0210
    Mu50:
    SAV0211 (acpD)
    MW2:
    MW0187 (acpD)
    RF122:
    SAB0149c
    ST398:
    SAPIG0221
    T0131:
    SAT0131_00196
    TCH60:
    HMPREF0772_10296
    TW20:
    SATW20_02120
    USA300_TCH1516:
    USA300HOU_0218
    VC40:
    SAVC_00795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGW
    N315            MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGW
    NCTC8325        MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGW
    Newman          MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGW
    USA300_FPR3757  MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLFETYIPVIDKDVLTGW
                    ************************************************************

    COL             GKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGK
    N315            GKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGK
    NCTC8325        GKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGK
    Newman          GKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGK
    USA300_FPR3757  GKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSFPPVVKAYIDAISIAGK
                    ************************************************************

    COL             TFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIII
    N315            TFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIII
    NCTC8325        TFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIII
    Newman          TFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIII
    USA300_FPR3757  TFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYLRTIMTFLGVPSYETIII
                    ************************************************************

    COL             EGHNAEPHKTEEIKATSINNAEKLATTF
    N315            EGHNAEPHKTEEIKATSINNAEKLATTF
    NCTC8325        EGHNAEPHKTEEIKATSINNAEKLATTF
    Newman          EGHNAEPHKTEEIKATSINNAEKLATTF
    USA300_FPR3757  EGHNAEPHKTEEIKATSINNAEKLATTF
                    ****************************