From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001064000
  • symbol?: malK
  • description?: multiple sugar-binding transport ATP-binding protein

      descriptions from strain specific annotations:

    • multiple sugar-binding transport ATP-binding protein
    • ABC transporter
    • maltose ABC transporter, ATP-binding protein, putative
    • Maltose/maltodextrin transport ATP-binding protein MalK
    • Multiple sugar ABC transporter, ATP-binding protein
    • ABC transporter ATP-binding protein ycjV
    • ABC transporter family protein
    • maltose ABC transporter ATP-binding protein
    • putative maltose ABC transporter ATP-binding protein
    • maltose/maltodextrin ABC transporter ATP-binding protein
    • maltose/maltodextrin ABC superfamily ATP binding cassette transporter, ABC protein
    • putative ABC transporter ATP-binding protein
    • sn-glycerol-3-phosphate import ATP-binding protein UgpC
  • strand?: +
  • coordinates?: 1341123..1342220
  • synteny block?: BlockID0005860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0206 (msmX)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0214 (malK)
    08BA02176:
    C248_0197
    11819-97:
    MS7_0199
    71193:
    ST398NM01_0223
    ECT-R 2:
    ECTR2_174
    ED133:
    SAOV_0151
    ED98:
    SAAV_0179
    HO 5096 0412:
    SAEMRSA15_01720
    JH1:
    SaurJH1_0204
    JH9:
    SaurJH9_0198
    JKD6008:
    SAA6008_00182 (msmX)
    JKD6159:
    SAA6159_00188 (msmX)
    LGA251:
    SARLGA251_01770
    M013:
    M013TW_0193
    MRSA252:
    SAR0205
    MSHR1132:
    SAMSHR1132_01790
    MSSA476:
    SAS0189
    Mu3:
    SAHV_0212 (msmX)
    Mu50:
    SAV0213 (msmX)
    MW2:
    MW0189 (msmX)
    RF122:
    SAB0151
    ST398:
    SAPIG0223
    T0131:
    SAT0131_00198 (dnaK)
    TCH60:
    HMPREF0772_10294
    TW20:
    SATW20_02140
    USA300_TCH1516:
    USA300HOU_0220
    VC40:
    SAVC_00805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGD
    N315            MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGD
    NCTC8325        MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGD
    Newman          MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGD
    USA300_FPR3757  MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKSTTLRMVAGLESITSGD
                    ************************************************************

    COL             FYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAE
    N315            FYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAE
    NCTC8325        FYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAE
    Newman          FYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAE
    USA300_FPR3757  FYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLRKVNKKEIEQKVNEAAE
                    ************************************************************

    COL             ILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKL
    N315            ILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKL
    NCTC8325        ILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKL
    Newman          ILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKL
    USA300_FPR3757  ILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRTEILKL
                    ************************************************************

    COL             HKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSPAM
    N315            HKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSPAM
    NCTC8325        HKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSPAM
    Newman          HKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSPAM
    USA300_FPR3757  HKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREIYDAPNCIFVAQFIGSPAM
                    ************************************************************

    COL             NMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFIQTSPE
    N315            NMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFIQTSPE
    NCTC8325        NMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFIQTSPE
    Newman          NMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFIQTSPE
    USA300_FPR3757  NMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIILGIRAEDIHEEPIFIQTSPE
                    ************************************************************

    COL             TQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMANDKITLAFDMNKCHFFDEKT
    N315            TQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMTNDKITLAFDMNKCHFFDEKT
    NCTC8325        TQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMANDKITLAFDMNKCHFFDEKT
    Newman          TQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMANDKITLAFDMNKCHFFDEKT
    USA300_FPR3757  TQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMANDKITLAFDMNKCHFFDEKT
                    ***************************************:********************

    COL             GNRIV
    N315            GNRIV
    NCTC8325        GNRIV
    Newman          GNRIV
    USA300_FPR3757  GNRIV
                    *****