From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001070000
  • symbol?:
  • description?: Gfo/Idh/MocA family oxidoreductase

      descriptions from strain specific annotations:

    • Gfo/Idh/MocA family oxidoreductase
    • NADH-dependent dehydrogenase
    • oxidoreductase, Gfo/Idh/MocA family
    • oxidoreductase , NAD-binding Rossmann fold family protein
    • oxidoreductase domain-containing protein
    • oxidoreductase family, NAD-binding Rossmann fold family protein
    • putative oxidoreductase
  • strand?: +
  • coordinates?: 1347156..1348196
  • synteny block?: BlockID0005920
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0219
    08BA02176:
    C248_0202
    11819-97:
    MS7_0204
    71193:
    ST398NM01_0228
    ECT-R 2:
    ECTR2_179
    ED133:
    SAOV_0156
    ED98:
    SAAV_0184
    HO 5096 0412:
    SAEMRSA15_01770
    JH1:
    SaurJH1_0209
    JH9:
    SaurJH9_0203
    JKD6008:
    SAA6008_00187 (mviM)
    JKD6159:
    SAA6159_00193 (mviM)
    LGA251:
    SARLGA251_01820
    M013:
    M013TW_0198
    MRSA252:
    SAR0210
    MSHR1132:
    SAMSHR1132_01840
    MSSA476:
    SAS0194
    Mu3:
    SAHV_0217
    Mu50:
    SAV0218
    MW2:
    MW0194
    RF122:
    SAB0157
    ST398:
    SAPIG0228
    T0131:
    SAT0131_00204 (rpsT)
    TCH60:
    HMPREF0772_10289
    TW20:
    SATW20_02190
    USA300_TCH1516:
    USA300HOU_0225
    VC40:
    SAVC_00830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKLKVGVIGVGGIAQDRHIPALLKLKDTVSLVAVQDINTVQMIDVAKRFNIPHAVETPS
    N315            MTKLKVGVIGVGGIAQDRHIPALLKLKDTVSLVAVQDINTVQMIDVAKRFNIPQAVETPS
    NCTC8325        MTKLKVGVIGVGGIAQDRHIPALLKLKDTVSLVAVQDINTVQMIDVAKRFNIPHAVETPS
    USA300_FPR3757  MTKLKVGVIGVGGIAQDRHIPALLKLKDTVSLVAVQDINTVQMIDVAKRFNIPHAVETPS
                    *****************************************************:******

    COL             ELFKLVDAVVICTPNKFHADLSIEALNHGVHVLCEKPMAMTTEECDRMIEAANKNHKLLT
    N315            ELFKLVDAVVICTPNKFHADLSIEALNHGVHVLCEKPMAMTTEECDRMIEAANKNHKLLT
    NCTC8325        ELFKLVDAVVICTPNKFHADLSIEALNHGVHVLCEKPMAMTTEECDRMIEAANKNHKLLT
    USA300_FPR3757  ELFKLVDAVVICTPNKFHADLSIEALNHGVHVLCEKPMAMTTEECDRMIEAANKNHKLLT
                    ************************************************************

    COL             VAYHYRHTDVAITAKKAIESGVVGKPLVARVQAMRRRKVPGWGVFTNKALQGGGSLIDYG
    N315            VAYHYRHTDVAMTAKKAIEAGVVGKPLVARVQAMRRRKVPGWGVFTNKALQGGGSLIDYG
    NCTC8325        VAYHYRHTDVAITAKKAIESGVVGKPLVARVQAMRRRKVPGWGVFTNKALQGGGSLIDYG
    USA300_FPR3757  VAYHYRHTDVAITAKKAIESGVVGKPLVARVQAMRRRKVPGWGVFTNKALQGGGSLIDYG
                    ***********:*******:****************************************

    COL             CHLLDLSLWLLGKDMVPHEVLGKTYNQLSKQPNQINDWGTFDHTKFDVDDHVTSYMTFAN
    N315            CHLLDLSLWLLGKDMVPHEVLGKTYNQLSKQPNQINDWGTFDHTKFDVDDHVTSYMTFAN
    NCTC8325        CHLLDLSLWLLGKDMVPHEVLGKTYNQLSKQPNQINDWGTFDHTKFDVDDHVTSYMTFAN
    USA300_FPR3757  CHLLDLSLWLLGKDMVPHEVLGKTYNQLSKQPNQINDWGTFDHTKFDVDDHVTSYMTFAN
                    ************************************************************

    COL             RASMQFECSWSANIKEDKVHVSLSGEDGGINLFPFEIYEPRFGTIFESKANVEHNEDIAG
    N315            RASMQFECSWSANIKEDKVHVSLSGEDGGINLFPFEIYEPRFGTIFESKANVEHNEDIAG
    NCTC8325        RASMQFECSWSANIKEDKVHVSLSGEDGGINLFPFEIYEPRFGTIFESKANVEHNEDIAG
    USA300_FPR3757  RASMQFECSWSANIKEDKVHVSLSGEDGGINLFPFEIYEPRFGTIFESKANVEHNEDIAG
                    ************************************************************

    COL             ERQARNFVNACLGIEEIVVKPEEARNVNALIEAIYRSDLDNKSIQL
    N315            ERQARNFVNACLGIEEIVVKPEEARNVNALIEAIYRSDLDNKSIQL
    NCTC8325        ERQARNFVNACLGIEEIVVKPEEARNVNALIEAIYRSDLDNKSIQL
    USA300_FPR3757  ERQARNFVNACLGIEEIVVKPEEARNVNALIEAIYRSDLDNKSIQL
                    **********************************************