From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001073000
  • symbol?:
  • description?: isoprenylcysteine carboxyl methyltransferase

      descriptions from strain specific annotations:

    • isoprenylcysteine carboxyl methyltransferase
    • isoprenylcysteine carboxyl methyltransferase family protein
    • isoprenylcysteine carboxyl methyltransferase (ICMT) family protein
    • membrane spanning protein
  • strand?: -
  • coordinates?: 1349640..1350134
  • synteny block?: BlockID0005950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0221
    08BA02176:
    C248_0204
    11819-97:
    MS7_0206
    71193:
    ST398NM01_0230
    ECT-R 2:
    ECTR2_181
    ED133:
    SAOV_0158
    ED98:
    SAAV_0186
    HO 5096 0412:
    SAEMRSA15_01790
    JH1:
    SaurJH1_0211
    JH9:
    SaurJH9_0205
    JKD6008:
    SAA6008_00189
    JKD6159:
    SAA6159_00195
    LGA251:
    SARLGA251_01840
    M013:
    M013TW_0200
    MRSA252:
    SAR0212
    MSHR1132:
    SAMSHR1132_01860
    MSSA476:
    SAS0196
    Mu3:
    SAHV_0219
    Mu50:
    SAV0220
    MW2:
    MW0196
    RF122:
    SAB0159c
    ST398:
    SAPIG0230
    T0131:
    SAT0131_00206
    TCH60:
    HMPREF0772_10287
    TW20:
    SATW20_02210
    USA300_TCH1516:
    USA300HOU_0228
    VC40:
    SAVC_00840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSFIYKILYVVKINAYTYDIMTEDIMILSILLIFFCIRLVSLKISINHSKQLKADGAVE
    N315            --------------------------MILSILLIFFCIRLVSLKISINHSKQLKADGAVE
    NCTC8325        MTSFIYKILYVVKINAYTYDIMTEDIMILSILLIFFCIRLVSLKISINHSKQLKADGAVE
    Newman          MTSFIYKILYVVKINAYTYDIMTEDIMILSILLIFFCIRLVSLKISINHSKQLKADGAVE
    USA300_FPR3757  MTSFIYKILYVVKINAYTYDIMTEDIMILSILLIFFCIRLVSLKISINHSKQLKADGAVE
                                              **********************************

    COL             YGVKNSKFLAITHVLIYVLAGVEAFINKDTFSFANGIGLVILIFAYIMLFMVIKTLGGIW
    N315            YGVKNSKFLAITHVLIYVLAGVEAFINKDTFSFANGIGLVILIFAYIMLFMVIKTLGGIW
    NCTC8325        YGVKNSKFLAITHVLIYVLAGVEAFINKDTFSFANGIGLVILIFAYIMLFMVIKTLGGIW
    Newman          YGVKNSKFLAITHVLIYVLAGVEAFINKDTFSFANGIGLVILIFAYIMLFMVIKTLGGIW
    USA300_FPR3757  YGVKNSKFLAITHVLIYVLAGVEAFINKDTFSFANGIGLVILIFAYIMLFMVIKTLGGIW
                    ************************************************************

    COL             TLKLFILPNHPIIKSGLYKITKHPNYFLNIIPELIGVLLLTHATYTTILLVPYAYFLYVR
    N315            TLKLFILPNHPIIKSGLYKITKHPNYFLNIIPELIGVLLLTHATYTTILLVPYAYFLYVR
    NCTC8325        TLKLFILPNHPIIKSGLYKITKHPNYFLNIIPELIGVLLLTHATYTTILLVPYAYFLYVR
    Newman          TLKLFILPNHPIIKSGLYKITKHPNYFLNIIPELIGVLLLTHATYTTILLVPYAYFLYVR
    USA300_FPR3757  TLKLFILPNHPIIKSGLYKITKHPNYFLNIIPELIGVLLLTHATYTTILLVPYAYFLYVR
                    ************************************************************

    COL             IKQEEKLMNI
    N315            IKQEEKLMNI
    NCTC8325        IKQEEKLMNI
    Newman          IKQEEKLMNI
    USA300_FPR3757  IKQEEKLMNI
                    **********