From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001074000
  • symbol?: uhpT
  • description?: sugar phosphate antiporter

      descriptions from strain specific annotations:

    • sugar phosphate antiporter
    • hexose phosphate transporter
    • hexose phosphate transport protein
    • Hexose phosphate transport protein UhpT
    • MFS family major facilitator transporter, hexose phosphate:cation symporter
    • phosphoglycerate transporter family protein
    • putative sugar phosphate transport protein
    • Sugar phosphate transport protein
  • strand?: +
  • coordinates?: 1350350..1351087
  • synteny block?: BlockID0005960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0200 (uhpT)
    N315:
    SA0214 (uhpT)
    NCTC8325:
    Newman:
    NWMN_0158 (uhpT)
    USA300_FPR3757:
    04-02981:
    SA2981_0222 (uhpT)
    08BA02176:
    C248_0205 (uhpT)
    11819-97:
    MS7_0207 (uhpT)
    71193:
    ST398NM01_0231
    ECT-R 2:
    ECTR2_182
    ED133:
    SAOV_0159
    ED98:
    SAAV_0187 (uhpT)
    HO 5096 0412:
    SAEMRSA15_01800 (uhpT)
    JH1:
    SaurJH1_0212 (uhpT)
    JH9:
    SaurJH9_0206 (uhpT)
    JKD6008:
    SAA6008_00190 (uhpT)
    JKD6159:
    SAA6159_00196
    LGA251:
    SARLGA251_01850 (uhpT)
    M013:
    M013TW_0201
    MRSA252:
    SAR0213 (uhpT)
    MSHR1132:
    SAMSHR1132_01870
    MSSA476:
    SAS0197 (uhpT)
    Mu3:
    SAHV_0220 (uhpT)
    Mu50:
    SAV0221 (uhpT)
    MW2:
    MW0197 (uhpT)
    RF122:
    SAB0160 (uhpT)
    ST398:
    SAPIG0231
    T0131:
    SAT0131_00207 (comEC)
    TCH60:
    HMPREF0772_10286 (uhpT)
    TW20:
    SATW20_02220 (uhpT)
    USA300_TCH1516:
    USA300HOU_0229 (uhpT)
    VC40:
    SAVC_00845 (uhpT)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPF
    N315            ------MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPF
    NCTC8325        ------MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPF
    Newman          MIEVTEMNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPF
    USA300_FPR3757  ------MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIRNNFKAAQPF
                          ******************************************************

    COL             LKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILSAITVLIMGFV
    N315            LKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILSAITVLIMGFV
    NCTC8325        LKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILSAITVLIMGFV
    Newman          LKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILSAITVLIMGFV
    USA300_FPR3757  LKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILSAITVLIMGFV
                    ************************************************************

    COL             LSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFWNTSHNIGGAIA
    N315            LSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFWNTSHNIGGAIA
    NCTC8325        LSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFWNTSHNIGGAIA
    Newman          LSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFWNTSHNIGGAIA
    USA300_FPR3757  LSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFWNTSHNIGGAIA
                    ************************************************************

    COL             GGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWNRAEEIWEEPVDK
    N315            GGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWNRAEEIWEEPVDK
    NCTC8325        GGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWNRAEEIWEEPVDK
    Newman          GGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWNRAEEIWEEPVDK
    USA300_FPR3757  GGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWNRAEEIWEEPVDK
                    ************************************************************

    COL             ENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA
    N315            ENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA
    NCTC8325        ENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA
    Newman          ENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA
    USA300_FPR3757  ENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPLYVSEHLHFSKGDA
                    ************************************************************

    COL             VNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLFYTNATSVMMVNISL
    N315            VNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLFYTNATSVMMVNISL
    NCTC8325        VNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLFYTNATSVMMVNISL
    Newman          VNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLFYTNATSVMMVNISL
    USA300_FPR3757  VNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLFYTNATSVMMVNISL
                    ************************************************************

    COL             FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADPTRNG
    N315            FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADPTRNG
    NCTC8325        FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADPTRNG
    Newman          FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADPTRNG
    USA300_FPR3757  FALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSMAKVGLAAIADPTRNG
                    ************************************************************

    COL             LNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLKI
    N315            LNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLKI
    NCTC8325        LNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLKI
    Newman          LNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLKI
    USA300_FPR3757  LNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLKI
                    *********************************************