From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001086000
  • symbol?:
  • description?: glycerophosphoryl diester phosphodiesterase

      descriptions from strain specific annotations:

    • glycerophosphoryl diester phosphodiesterase
    • Glycerophosphoryl diester phosphodiesterase, periplasmic
    • glycerophosphodiester phosphodiesterase
    • glycerophosphoryl diester phosphodiesterase family protein
    • Membrane domain of membrane-anchored glycerophosphoryl diester phosphodiesterase
  • strand?: +
  • coordinates?: 1360382..1362196
  • synteny block?: BlockID0006080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0228
    08BA02176:
    C248_0212
    11819-97:
    MS7_0214
    71193:
    ST398NM01_0238
    ECT-R 2:
    ECTR2_188
    ED133:
    SAOV_0165
    ED98:
    SAAV_0193
    HO 5096 0412:
    SAEMRSA15_01860
    JH1:
    SaurJH1_0218
    JH9:
    SaurJH9_0212
    JKD6008:
    SAA6008_00197 (glpQ1)
    JKD6159:
    SAA6159_00202 (glpQ1)
    LGA251:
    SARLGA251_01920
    M013:
    M013TW_0207
    MRSA252:
    SAR0220
    MSHR1132:
    SAMSHR1132_01930
    MSSA476:
    SAS0204
    Mu3:
    SAHV_0227
    Mu50:
    SAV0228
    MW2:
    MW0204
    RF122:
    SAB0167
    ST398:
    SAPIG0238
    T0131:
    SAT0131_00215
    TCH60:
    HMPREF0772_10277 (glpQ)
    TW20:
    SATW20_02290
    USA300_TCH1516:
    USA300HOU_0236 (glpQ1)
    VC40:
    SAVC_00880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------MKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLIL
    N315            -----------------MKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLIL
    NCTC8325        -----------------MKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLIL
    Newman          MKNIKMKLNIKAMRSVIMKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLIL
    USA300_FPR3757  -----------------MKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLIL
                                     *******************************************

    COL             LFNMMLKVAGQSQLTINNWTEIVSHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDR
    N315            LFNMMLKVAGQSQLTINNWMEIISHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDR
    NCTC8325        LFNMMLKVAGQSQLTINNWTEIVSHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDR
    Newman          LFNMMLKVAGQSQLTINNWTEIVSHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDR
    USA300_FPR3757  LFNMMLKVAGQSQLTINNWTEIVSHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDR
                    ******************* **:*************************************

    COL             QIITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
    N315            QIITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
    NCTC8325        QIITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
    Newman          QIITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
    USA300_FPR3757  QIITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
                    ************************************************************

    COL             MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIEI
    N315            MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIEI
    NCTC8325        MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIEI
    Newman          MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIEI
    USA300_FPR3757  MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIEI
                    ************************************************************

    COL             VILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLISV
    N315            VILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLISV
    NCTC8325        VILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLISV
    Newman          VILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLISV
    USA300_FPR3757  VILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLISV
                    ************************************************************

    COL             LVLHLKQENVLDQPGLEFKYPKPKRKSRFFIISMVLAVTCFIGYNMYLLYNNTINTNISI
    N315            LVLHLKQENVLDQPGLEFKYPKSKRKSRFFIISMVLAVTCFIGYNMYLLYNNTINTNISI
    NCTC8325        LVLHLKQENVLDQPGLEFKYPKPKRKSRFFIISMVLAVTCFIGYNMYLLYNNTINTNISI
    Newman          LVLHLKQENVLDQPGLEFKYPKPKRKSRFFIISMVLAVTCFIGYNMYLLYNNTINTNISI
    USA300_FPR3757  LVLHLKQENVLDQPGLEFKYPKPKRKSRFFIISMVLAVTCFIGYNMYLLYNNTINTNISI
                    **********************.*************************************

    COL             IGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVNKNIS
    N315            IGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVNKNIS
    NCTC8325        IGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVNKNIS
    Newman          IGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVNKNIS
    USA300_FPR3757  IGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVNKNIS
                    ************************************************************

    COL             ESNFKDIVGLKMRQNGHEAKFVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQRVIDIL
    N315            ESNFKDVVGLKMRQNGHEAKLVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQRVIDIL
    NCTC8325        ESNFKDIVGLKMRQNGHEAKFVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQRVIDIL
    Newman          ESNFKDIVGLKMRQNGHEAKFVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQRVIDIL
    USA300_FPR3757  ESNFKDIVGLKMRQNGHEAKFVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQRVIDIL
                    ******:*************:***************************************

    COL             KKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIEDFSYSPR
    N315            KKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIEDFSYSPR
    NCTC8325        KKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIEDFSYSPR
    Newman          KKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIEDFSYSPR
    USA300_FPR3757  KKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIEDFSYSPR
                    ************************************************************

    COL             LVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDETYFDRSIR
    N315            LVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDETYFDRSIR
    NCTC8325        LVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDETYFDRSIR
    Newman          LVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDETYFDRSIR
    USA300_FPR3757  LVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDETYFDRSIR
                    ************************************************************

    COL             ILFE
    N315            ILFE
    NCTC8325        ILFE
    Newman          ILFE
    USA300_FPR3757  ILFE
                    ****