From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001087000
  • symbol?:
  • description?: complement inhibitor SCIN family protein

      descriptions from strain specific annotations:

    • complement inhibitor SCIN family protein
    • hyothetical protein
    • Staphylococcal complement inhibitor SCIN
  • strand?: -
  • coordinates?: 1362410..1362754
  • synteny block?: BlockID0006090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0229
    08BA02176:
    C248_0213
    11819-97:
    MS7_0215
    71193:
    ST398NM01_0239
    ECT-R 2:
    ECTR2_189
    ED133:
    SAOV_0166
    ED98:
    SAAV_0194
    HO 5096 0412:
    SAEMRSA15_01870
    JH1:
    SaurJH1_0219
    JH9:
    SaurJH9_0213
    JKD6008:
    SAA6008_00198
    JKD6159:
    SAA6159_00203
    LGA251:
    SARLGA251_01930
    M013:
    M013TW_0208
    MRSA252:
    SAR0221
    MSHR1132:
    SAMSHR1132_01940
    MSSA476:
    SAS0205
    Mu3:
    SAHV_0228
    Mu50:
    SAV0229
    MW2:
    MW0205
    RF122:
    SAB0168c
    ST398:
    SAPIG0239
    T0131:
    SAT0131_00216
    TCH60:
    HMPREF0772_10276
    TW20:
    SATW20_02300
    USA300_TCH1516:
    USA300HOU_0237
    VC40:
    SAVC_00885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVDQLHELIANTDLNKLS
    N315            MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVDQLHELIANTDLNKLS
    NCTC8325        MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVDQLHELIANTDLNKLS
    Newman          MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVDQLHELIANTDLNKLS
    USA300_FPR3757  MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVDQLHELIANTDLNKLS
                    ************************************************************

    COL             YLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
    N315            YLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
    NCTC8325        YLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
    Newman          YLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
    USA300_FPR3757  YLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHSQNN
                    ******************************************************