From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001111000
  • symbol?:
  • description?: inosine-uridine preferring nucleoside hydrolase

      descriptions from strain specific annotations:

    • inosine-uridine preferring nucleoside hydrolase
    • purine nucleosidase
    • inosine-uridine preferring nucleoside hydrolase family protein
    • pyrimidine-specific ribonucleoside hydrolase rihA
    • pyrimidine-specific ribonucleoside hydrolase RihA (Cytidine/uridine-specific hydrolase)
    • inosine/uridine-preferring nucleoside hydrolase
    • putative inosine-uridine preferring nucleosidehydrolase
    • cytidine/uridine-specific hydrolase
    • ribosylpyrimidine nucleosidase
  • strand?: +
  • coordinates?: 1388087..1389022
  • synteny block?: BlockID0006310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0243
    08BA02176:
    C248_0229
    11819-97:
    MS7_0230 (rihA)
    71193:
    ST398NM01_0255
    ECT-R 2:
    ECTR2_204
    ED133:
    SAOV_0181
    ED98:
    SAAV_0209
    HO 5096 0412:
    SAEMRSA15_02020
    JH1:
    SaurJH1_0234
    JH9:
    SaurJH9_0228
    JKD6008:
    SAA6008_00215 (rihA)
    JKD6159:
    SAA6159_00220 (rihA)
    LGA251:
    SARLGA251_02070
    M013:
    M013TW_0223
    MRSA252:
    SAR0236
    MSHR1132:
    SAMSHR1132_02110
    MSSA476:
    SAS0219
    Mu3:
    SAHV_0242
    Mu50:
    SAV0243
    MW2:
    MW0219
    RF122:
    SAB0182
    ST398:
    SAPIG0255
    T0131:
    SAT0131_00234
    TCH60:
    HMPREF0772_10260 (rihA)
    TW20:
    SATW20_02450
    USA300_TCH1516:
    USA300HOU_0253
    VC40:
    SAVC_00955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDKNTTNALNVLDIMGRQ
    N315            MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDKNTTNALNVLDIMGRQ
    NCTC8325        MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDKNTTNALNVLDIMGRQ
    Newman          MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDKNTTNALNVLDIMGRQ
    USA300_FPR3757  MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDKNTTNALNVLDIMGRQ
                    ************************************************************

    COL             DIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAMPASDVIINKVMTSDTP
    N315            DIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAMPASDVIINKVMTSDTP
    NCTC8325        DIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAMPASDVIINKVMTSDTP
    Newman          DIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAMPASDVIINKVMTSDTP
    USA300_FPR3757  DIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAMPASDVIINKVMTSDTP
                    ************************************************************

    COL             VTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPTAEFNIWVDAEAAKRVFE
    N315            VTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPTAEFNIWVDAEAAKRVFE
    NCTC8325        VTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPTAEFNIWVDAEAAKRVFE
    Newman          VTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPTAEFNIWVDAEAAKRVFE
    USA300_FPR3757  VTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPTAEFNIWVDAEAAKRVFE
                    ************************************************************

    COL             SGITINVFGLDVTHQVLADDHVIERFESINNPVAQFVVELLQFFKKTYKTHFNMDGGPIH
    N315            SGITINVFGLDVTHQVLADNHVIERFESINNPVAQFVVELLQFFKKTYKTHFNMDGGPIH
    NCTC8325        SGITINVFGLDVTHQVLADDHVIERFESINNPVAQFVVELLQFFKKTYKTHFNMDGGPIH
    Newman          SGITINVFGLDVTHQVLADDHVIERFESINNPVAQFVVELLQFFKKTYKTHFNMDGGPIH
    USA300_FPR3757  SGITINVFGLDVTHQVLADDHVIERFESINNPVAQFVVELLQFFKKTYKTHFNMDGGPIH
                    *******************:****************************************

    COL             DACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHVTGKPANAYFATAVDVEEVW
    N315            DACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHVTGKPANAYFATAVDVEEVW
    NCTC8325        DACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHVTGKPANAYFATAVDVEEVW
    Newman          DACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHVTGKPANAYFATAVDVEEVW
    USA300_FPR3757  DACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHVTGKPANAYFATAVDVEEVW
                    ************************************************************

    COL             NLIDHKLRTYE
    N315            NLIDHKLRTYE
    NCTC8325        NLIDHKLRTYE
    Newman          NLIDHKLRTYE
    USA300_FPR3757  NLIDHKLRTYE
                    ***********