From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001116000
  • symbol?:
  • description?: PTS transport system, IIA component

      descriptions from strain specific annotations:

    • PTS transport system, IIA component
    • PTS transporter subunit IIA-like nitrogen-regulatory protein PtsN
    • phosphoenolpyruvate-dependent sugar phosphotransferase system EIIA 2
    • PTS system, sugar-specific IIA component, putative
    • PTS system, galactitol-specific IIA component
    • phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 family protein
    • PTS system, fructose-specific enzyme II, BC component
    • PTS family porter component IIA
    • PTS system galactitol-specific transporter subunit IIA
    • putative PTS transport system IIA component
    • phosphotransferase system enzyme
    • putative PTS transport system, IIA component
    • phosphoenolpyruvate-dependent sugar phosphotransferase system, eiia 2, putative
    • PTS transport system transporter subunit IIA
  • strand?: +
  • coordinates?: 1391453..1391920
  • synteny block?: BlockID0006360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0245
    08BA02176:
    C248_0231
    11819-97:
    MS7_0233
    71193:
    ST398NM01_0257
    ECT-R 2:
    ECTR2_206
    ED133:
    SAOV_0183
    ED98:
    SAAV_0211
    HO 5096 0412:
    SAEMRSA15_02040
    JH1:
    SaurJH1_0236
    JH9:
    SaurJH9_0230
    JKD6008:
    SAA6008_00218
    JKD6159:
    SAA6159_00222
    LGA251:
    SARLGA251_02090
    M013:
    M013TW_0226
    MRSA252:
    SAR0240
    MSHR1132:
    SAMSHR1132_02130
    MSSA476:
    SAS0221
    Mu3:
    SAHV_0244
    Mu50:
    SAV0245
    MW2:
    MW0221
    RF122:
    SAB0184
    ST398:
    SAPIG0257
    T0131:
    SAT0131_00236 (mtn)
    TCH60:
    HMPREF0772_10258
    TW20:
    SATW20_02470
    USA300_TCH1516:
    USA300HOU_0256
    VC40:
    SAVC_00965

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAVIDREKEFATGLPTHL
    N315            MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAVIDREKEFATGLPTHL
    NCTC8325        MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAVIDREKEFATGLPTHL
    Newman          MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAVIDREKEFATGLPTHL
    USA300_FPR3757  MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAVIDREKEFATGLPTHL
                    ************************************************************

    COL             CSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIVFMLAMDKVDDQLKLLQ
    N315            CSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIVFMLAMDKVDDQLKLLQ
    NCTC8325        CSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIVFMLAMDKVDDQLKLLQ
    Newman          CSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIVFMLAMDKVDDQLKLLQ
    USA300_FPR3757  CSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIVFMLAMDKVDDQLKLLQ
                    ************************************************************

    COL             QLMQIFQSEEKLEQILRTKDETILATLINDYLEYN
    N315            QLMQIFQSEEKLEQILRTKDETILATLINDYLEYN
    NCTC8325        QLMQIFQSEEKLEQILRTKDETILATLINDYLEYN
    Newman          QLMQIFQSEEKLEQILRTKDETILATLINDYLEYN
    USA300_FPR3757  QLMQIFQSEEKLEQILRTKDETILATLINDYLEYN
                    ***********************************