From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001119000
  • symbol?:
  • description?: PTS galactitol-specific transporter subunit IIC

      descriptions from strain specific annotations:

    • PTS galactitol-specific transporter subunit IIC
    • PTS galactitol-specific enzyme IIC component
    • PTS system galactitol-specific transporter subunit IIC
    • PTS system, sorbitol-specific IIC component
    • PTS system, galactitol-specific IIC component
    • putative phosphotransferase D-arabitol specific component IIC
    • PTS transport system, IIC component
    • PTS system protein
    • PTS family galactitol (gat) porter component IIC
    • putative PTS transport system, IIC component
    • PTS system, galactitol-specific IIC component family protein
    • PTS system galactitol-specific IIC component
    • PTS system galactitol (gat) transporter subunit IIC
    • phosphotransferase system galactitol-specific enzyme II, C component
    • galactitol permease iic component (pts system galactitol-specific eiiccomponent) (eiic-gat)
    • PTS transport system transporter subunit IIC
  • strand?: +
  • coordinates?: 1392460..1393719
  • synteny block?: BlockID0006390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0238 (gatC)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0247 (gatC)
    08BA02176:
    C248_0234
    11819-97:
    MS7_0235
    71193:
    ST398NM01_0259
    ECT-R 2:
    ECTR2_208
    ED133:
    SAOV_0186
    ED98:
    SAAV_0214
    HO 5096 0412:
    SAEMRSA15_02060
    JH1:
    SaurJH1_0238
    JH9:
    SaurJH9_0232
    JKD6008:
    SAA6008_00220
    JKD6159:
    SAA6159_00224
    LGA251:
    SARLGA251_02110
    M013:
    M013TW_0228
    MRSA252:
    SAR0242
    MSHR1132:
    SAMSHR1132_02150
    MSSA476:
    SAS0223
    Mu3:
    SAHV_0246 (gatC)
    Mu50:
    SAV0247 (gatC)
    MW2:
    MW0223 (gatC)
    RF122:
    SAB0186
    ST398:
    SAPIG0259
    T0131:
    SAT0131_00238
    TCH60:
    HMPREF0772_10256 (gatC)
    TW20:
    SATW20_02490
    USA300_TCH1516:
    USA300HOU_0258 (gatC1)
    VC40:
    SAVC_00975

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTIGVAFVGIFLVIDLLV
    N315            MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTIGVAFVGIFLVIDLLV
    NCTC8325        MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTIGVAFVGIFLVIDLLV
    Newman          MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTIGVAFVGIFLVIDLLV
    USA300_FPR3757  MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTIGVAFVGIFLVIDLLV
                    ************************************************************

    COL             KNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPLGIIVNVVLLVTKVTKT
    N315            KNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPLGIIVNVVLLVTKVTKT
    NCTC8325        KNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPLGIIVNVVLLVTKVTKT
    Newman          KNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPLGIIVNVVLLVTKVTKT
    USA300_FPR3757  KNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPLGIIVNVVLLVTKVTKT
                    ************************************************************

    COL             MNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQIICLKVADWTAPMMSEFFDLPGVS
    N315            MNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQVICLKVADWTAPMMSEFFDLPGVS
    NCTC8325        MNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQIICLKVADWTAPMMSEFFDLPGVS
    Newman          MNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQIICLKVADWTAPMMSEFFDLPGVS
    USA300_FPR3757  MNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQIICLKVADWTAPMMSEFFDLPGVS
                    ************************************:***********************

    COL             IATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAFGESIFVGLILGLGIGVLA
    N315            IATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAFGESIFVGLILGLGIGVLA
    NCTC8325        IATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAFGESIFVGLILGLGIGVLA
    Newman          IATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAFGESIFVGLILGLGIGVLA
    USA300_FPR3757  IATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAFGESIFVGLILGLGIGVLA
                    ************************************************************

    COL             GYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESARTWLNKRFGEREIYIGLDAAV
    N315            GYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESARTWLNKRFGEREIYIGLDAAV
    NCTC8325        GYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESARTWLNKRFGEREIYIGLDAAV
    Newman          GYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESARTWLNKRFGEREIYIGLDAAV
    USA300_FPR3757  GYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESARTWLNKRFGEREIYIGLDAAV
                    ************************************************************

    COL             ALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIPFVVAFIVGAARGNIIHSVIV
    N315            ALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIPFVVAFIVGAARGNIIHSVIV
    NCTC8325        ALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIPFVVAFIVGAARGNIIHSVIV
    Newman          ALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIPFVVAFIVGAARGNIIHSVIV
    USA300_FPR3757  ALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIPFVVAFIVGAARGNIIHSVIV
                    ************************************************************

    COL             GTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISSIDQGGNIVNYLIFKLFSLFN
    N315            GTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISSIDQGGNIVNYLIFKLFSLFN
    NCTC8325        GTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISSIDQGGNIVNYLIFKLFSLFN
    Newman          GTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISSIDQGGNIVNYLIFKLFSLFN
    USA300_FPR3757  GTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISSIDQGGNIVNYLIFKLFSLFN
                    ***********************************************************